PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os01g72370.1 | ||||||||
Common Name | LOC4325750, OsJ_04787, P0431G06.13-1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 249aa MW: 27089.7 Da PI: 6.0338 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 44.3 | 3.3e-14 | 69 | 121 | 1 | 55 |
CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 r+ +hn+ Er RR+++N+ ++ Lr llP a + kKls +++ ++ +YI +Lq LOC_Os01g72370.1 69 RKLSHNAYERDRRKQLNELYSSLRALLPDA--DHTKKLSIPTTVSRVLKYIPELQ 121 6889*************************7..35666***************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47459 | 3.53E-16 | 66 | 136 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
PROSITE profile | PS50888 | 13.954 | 68 | 120 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
CDD | cd00083 | 4.35E-12 | 68 | 125 | No hit | No description |
Gene3D | G3DSA:4.10.280.10 | 8.4E-13 | 69 | 136 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 2.0E-11 | 69 | 121 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SMART | SM00353 | 8.4E-10 | 74 | 126 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0010106 | Biological Process | cellular response to iron ion starvation | ||||
GO:0055072 | Biological Process | iron ion homeostasis | ||||
GO:0090575 | Cellular Component | RNA polymerase II transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MEQLFVDDPA FASSMSSLEA DIFSGAGQLP SSPWLDLDLD DDVQDLSMAP TTANAVSSGY 60 GSGGSGSHRK LSHNAYERDR RKQLNELYSS LRALLPDADH TKKLSIPTTV SRVLKYIPEL 120 QKQVENLERK KKELTTTSTT NCKPGVLGSQ LMSEGMAPIV SATCINDMEI MVQVSLLSNV 180 AGSVLPLSKC IKVLENEGLH FISSSTSSGF GNRTFYSIHL QRSEGTINEE CPAFCERLEK 240 VVRNKAKL* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.21893 | 0.0 | callus| leaf| root| seed| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32983408 | 0.0 | ||||
Expression Atlas | Q941Z7 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os01g72370.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os01g72370 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK073385 | 0.0 | AK073385.1 Oryza sativa Japonica Group cDNA clone:J033041D19, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612709.1 | 0.0 | protein IRON-RELATED TRANSCRIPTION FACTOR 2 isoform X1 | ||||
Swissprot | A2WZ60 | 0.0 | IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2 | ||||
TrEMBL | A0A0D3EYS0 | 0.0 | A0A0D3EYS0_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0D9YK46 | 0.0 | A0A0D9YK46_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0CD21 | 0.0 | A0A0E0CD21_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0FYV7 | 0.0 | A0A0E0FYV7_ORYNI; Uncharacterized protein | ||||
TrEMBL | I1NVB2 | 0.0 | I1NVB2_ORYGL; Uncharacterized protein | ||||
STRING | OGLUM01G48440.3 | 0.0 | (Oryza glumipatula) | ||||
STRING | ONIVA01G50120.1 | 0.0 | (Oryza nivara) | ||||
STRING | ORGLA01G0380200.1 | 0.0 | (Oryza glaberrima) | ||||
STRING | OBART01G44150.1 | 0.0 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3280 | 34 | 72 | Representative plant | OGRP2826 | 11 | 29 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56970.1 | 2e-32 | bHLH family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os01g72370.1 |
Entrez Gene | 4325750 |
Publications ? help Back to Top | |||
---|---|---|---|
|