PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os01g55340.1 | ||||||||
Common Name | B1131G08.10, LOC4325308, Os01g0758200, OSNPB_010758200 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 212aa MW: 23094.8 Da PI: 9.0833 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 120.6 | 5.7e-38 | 107 | 162 | 4 | 59 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grrkn+ LOC_Os01g55340.1 107 APLPCPRCRSRDTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRKNR 162 5689**************************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50884 | 28.751 | 109 | 163 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 2.0E-26 | 109 | 162 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.3E-31 | 109 | 162 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 111 | 147 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009066 | anatomy | anther | ||||
PO:0001004 | developmental stage | anther development stage | ||||
PO:0007130 | developmental stage | sporophyte reproductive stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 212 aa Download sequence Send to blast |
MLSHVEMAPA AGGFKLFGKV IMQCGVSEGT QDKAQGFVVA REKVEPEEEE EEEQRVPAAA 60 TSGQRASIKR EAADRDEEQR QGGGDAAGQP TQRRLQDSAE ARAAAAAPLP CPRCRSRDTK 120 FCYFNNYNVN QPRHFCKACH RYWTAGGALR NVPVGAGRRK NRPLGPLAVA HHNHHHRAAA 180 GFVLGFPNPS SPTSPSPVYT DRWPVTPDRP F* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.100818 | 0.0 | flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32981106 | 0.0 | ||||
Expression Atlas | Q5JLR7 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in germinating seeds 3 to 5 days after imbibition. {ECO:0000269|PubMed:11470159}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os01g55340.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os01g55340 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK071083 | 0.0 | AK071083.1 Oryza sativa Japonica Group cDNA clone:J023076F14, full insert sequence. | |||
GenBank | AP003409 | 0.0 | AP003409.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:B1131G08. | |||
GenBank | AP014957 | 0.0 | AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015630447.1 | 1e-156 | dof zinc finger protein 5 | ||||
Swissprot | Q5JLR7 | 1e-157 | DOF5_ORYSJ; Dof zinc finger protein 5 | ||||
TrEMBL | A2ZY02 | 1e-149 | A2ZY02_ORYSJ; Uncharacterized protein | ||||
STRING | OS01T0758200-01 | 1e-155 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6495 | 28 | 51 | Representative plant | OGRP38 | 17 | 445 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-33 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os01g55340.1 |
Entrez Gene | 4325308 |
Publications ? help Back to Top | |||
---|---|---|---|
|