PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os01g34060.1
Common NameLOC4323963, OJ1005_B10.31, Os01g0524500, OSNPB_010524500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 307aa    MW: 31912.6 Da    PI: 7.8962
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os01g34060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.92e-12143187347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  LOC_Os01g34060.1 143 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 187
                       7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.61475IPR001005SANT/Myb domain
PROSITE profilePS500904.7041873IPR017877Myb-like domain
PROSITE profilePS5129416.873136192IPR017930Myb domain
SuperFamilySSF466897.9E-17138193IPR009057Homeodomain-like
SMARTSM007172.3E-10140190IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.3E-17140190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.6E-11141186IPR009057Homeodomain-like
CDDcd001671.06E-9143188No hitNo description
PfamPF002497.6E-11143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTSQAATTTT TAAAAAAWTR EDDKAFENAL AACAAPPPAD GGAPDDDWFA ALAASVPGAR  60
SAEEVRRHYE ALVEDVAAID AGRVPLPRYA GEESAAPPDG AGAAAAASKD GGHRRDERKG  120
GGGGYDGGKS CSKAEQERRK GIPWTEEEHR LFLLGLDKFG KGDWRSISRN FVISRTPTQV  180
ASHAQKYFIR LNSMNRDRRR SSIHDITSVT AGDQVAAQQG APITGHQATG NPAAAALGPP  240
GMKHHHHHHP GGAPPPMPMY SAAPMGHPVA GHMVPAAVGT PVVFPPGHAP YVVPVGYPAP  300
PAKMHQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.153380.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO248503020.0
Expression AtlasQ8LH59-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in aboveground tissues, with the highest level in leaves. {ECO:0000269|PubMed:12172034}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}.
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os01g34060.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs01g34060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1510420.0AY151042.1 Oryza sativa (japonica cultivar-group) transcription factor MYBS1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627636.10.0transcription factor MYBS1
SwissprotB8A9B20.0MYBS1_ORYSI; Transcription factor MYBS1
SwissprotQ8LH590.0MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBLA0A0E0FMH60.0A0A0E0FMH6_ORYNI; Uncharacterized protein
STRINGONIVA01G20310.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94663041
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.14e-48MYB family protein
Publications ? help Back to Top
  1. Lu CA,Ho TH,Ho SL,Yu SM
    Three novel MYB proteins with one DNA binding repeat mediate sugar and hormone regulation of alpha-amylase gene expression.
    Plant Cell, 2002. 14(8): p. 1963-80
    [PMID:12172034]
  2. Hong YF, et al.
    Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.
    Plant Cell, 2012. 24(7): p. 2857-73
    [PMID:22773748]