PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | LOC_Os01g19694.1 | ||||||||
Common Name | B1146F03.18, HOS16, LOC4325788, Os01g0302500, OSH6, P0035H10.13 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 302aa MW: 32735.8 Da PI: 6.5194 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 28.8 | 2.1e-09 | 235 | 268 | 22 | 55 |
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+++gL+ +q+ +WF N+R ++ LOC_Os01g19694.1 235 WPYPTEEDKLRLAARTGLDPKQINNWFINQRKRH 268 59*****************************885 PP | |||||||
2 | ELK | 33.2 | 1.2e-11 | 188 | 209 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ LOC_Os01g19694.1 188 ELKEMLLKKYSGCLSRLRSEFL 209 9********************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01255 | 8.1E-21 | 41 | 85 | IPR005540 | KNOX1 |
Pfam | PF03790 | 3.6E-20 | 43 | 83 | IPR005540 | KNOX1 |
SMART | SM01256 | 2.5E-28 | 91 | 142 | IPR005541 | KNOX2 |
Pfam | PF03791 | 1.5E-24 | 94 | 141 | IPR005541 | KNOX2 |
SMART | SM01188 | 3.6E-6 | 188 | 209 | IPR005539 | ELK domain |
Pfam | PF03789 | 1.4E-8 | 188 | 209 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 10.423 | 188 | 208 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.843 | 208 | 271 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 4.28E-19 | 210 | 273 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 1.1E-13 | 210 | 275 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 6.5E-27 | 213 | 271 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 1.46E-13 | 220 | 272 | No hit | No description |
Pfam | PF05920 | 6.4E-17 | 228 | 267 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 246 | 269 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010073 | Biological Process | meristem maintenance | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009049 | anatomy | inflorescence | ||||
PO:0001083 | developmental stage | inflorescence development stage | ||||
PO:0007006 | developmental stage | IL.00 inflorescence just visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 302 aa Download sequence Send to blast |
MEDLYSIHPG ISRVGGAASE ASGVGVVVGG GGGSSSSDLT ELMKAQIAGH PRYPTLLSAY 60 IECRKVGAPP EVASLLKEIG RERRAGGGGG GAGQIGVDPE LDEFMEAYCR VLVRYKEELS 120 RPFDEAASFL SSIQTQLSNL CSGATSPPAT TATHSDEMVG SSDEDQCSGE TDMLDIGQEQ 180 SSRLADHELK EMLLKKYSGC LSRLRSEFLK KRKKGKLPKD ARSALLEWWN THYRWPYPTE 240 EDKLRLAART GLDPKQINNW FINQRKRHWK PSDGMRFALM EGVAGGSSGT TLYFDTGTIG 300 P* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 203 | 212 | LRSEFLKKRK |
2 | 209 | 213 | KKRKK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.4163 | 0.0 | panicle| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 116010677 | 0.0 | ||||
Expression Atlas | Q9FP29 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed in the early globular stage embryo before 2 days after pollination (DAP), but not in the endosperm. At 3 and 4 DAP, expression is restricted to the region around or just below the center of the ventral side of the embryo, where the shoot apex subsequently arises. During the transition to the shoot apex differentiation stage, expression is divided between the upper and basal regions of the shoot area, and the notch between the first leaf primordium and epiblast, respectively. When the first leaf primordia is evident, expression is localized to the notches between the shoot apical meristem (SAM) and the first leaf primordium and the putative second leaf primordium. Expressed uniformly in the inflorescence meristem, but after the transition from inflorescence to the floral phase, located specifically in the notches between the floral meristem and glume primordia. At later stages of flower development, uniformly expressed throughout the corpus of the meristem, and in the notches between glume primordia, but less well defined than in the previous stage. {ECO:0000269|PubMed:10488233}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that may be involved in shoot formation during early embryogenesis. {ECO:0000269|PubMed:10488233}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00670 | PBM | Transfer from GRMZM2G087741 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | LOC_Os01g19694.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
RiceGE | Os01g19694 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB028883 | 0.0 | AB028883.1 Oryza sativa mRNA for knotted1-type homeobox protein OSH6, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015634297.1 | 0.0 | homeobox protein knotted-1-like 1 | ||||
Swissprot | Q9FP29 | 0.0 | KNOS1_ORYSJ; Homeobox protein knotted-1-like 1 | ||||
TrEMBL | A0A0E0MV67 | 0.0 | A0A0E0MV67_ORYRU; Uncharacterized protein | ||||
STRING | ORUFI01G13730.1 | 0.0 | (Oryza rufipogon) | ||||
STRING | OS01T0302500-01 | 0.0 | (Oryza sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1698 | 38 | 92 | Representative plant | OGRP167 | 17 | 148 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G23380.1 | 2e-78 | KNOTTED1-like homeobox gene 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | LOC_Os01g19694.1 |
Entrez Gene | 4325788 |
Publications ? help Back to Top | |||
---|---|---|---|
|