PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA029380-PA | ||||||||
Common Name | OsI_32154 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 285aa MW: 31171.9 Da PI: 6.1653 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.9 | 6.2e-15 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l + G +W+++++ g+ R++k+c++rw +yl BGIOSGA029380-PA 14 RGPWTAEEDKKLMSFILTNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 89******************************99************97 PP | |||||||
2 | Myb_DNA-binding | 53.2 | 6.7e-17 | 70 | 111 | 4 | 47 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ BGIOSGA029380-PA 70 LTDAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111 5899***************.*********.************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.4E-20 | 5 | 62 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.116 | 9 | 61 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.4E-26 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.4E-11 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.9E-14 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.76E-8 | 16 | 61 | No hit | No description |
PROSITE profile | PS51294 | 28.032 | 62 | 116 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-25 | 63 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.2E-15 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.1E-15 | 70 | 111 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 2.00E-12 | 71 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:2000652 | Biological Process | regulation of secondary cell wall biogenesis | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 285 aa Download sequence Send to blast |
MGRQPCCDKL GVKRGPWTAE EDKKLMSFIL TNGHCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL TDAEEQLVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG 120 IDPVTHEPLD RKQESPATTS QSTVTAESSK SGEATRQQSR QLDDAVVRDM SVSAGGDSPP 180 ESSTNTASTA GGSSSSSSSH HQDPLVKWLL EEDLLPTGDE PWLNFTASND VDEFSSIAAT 240 GATPALPWDV GMTTDWLLDY QDFGMGDSSL VVDASMVNSS NGSNF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-27 | 14 | 116 | 7 | 108 | B-MYB |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.21636 | 0.0 | callus| flower| leaf| panicle| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 37990646 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269|PubMed:15805488}. | |||||
Uniprot | TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269|PubMed:15805488}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269|PubMed:15805488}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK111740 | 0.0 | AK111740.1 Oryza sativa Japonica Group cDNA clone:J023047I22, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612200.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612203.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612204.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612205.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612206.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612207.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612208.1 | 0.0 | protein ODORANT1 | ||||
Refseq | XP_015612209.1 | 0.0 | protein ODORANT1 | ||||
Swissprot | Q50EX6 | 5e-94 | ODO1_PETHY; Protein ODORANT1 | ||||
TrEMBL | B8BDU7 | 0.0 | B8BDU7_ORYSI; Uncharacterized protein | ||||
TrEMBL | I1QQP6 | 0.0 | I1QQP6_ORYGL; Uncharacterized protein | ||||
TrEMBL | Q69SH8 | 0.0 | Q69SH8_ORYSJ; Os09g0532900 protein | ||||
STRING | OS09T0532900-04 | 0.0 | (Oryza sativa) | ||||
STRING | ORGLA09G0137500.1 | 0.0 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP79 | 38 | 563 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G12350.1 | 3e-87 | myb domain protein 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|