PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA028769-PA | ||||||||
Common Name | OsI_29435 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 200aa MW: 21598.3 Da PI: 6.9148 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 48.4 | 2.1e-15 | 14 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 + +WT+eEde l +av+++ +W+ Ia ++ +R +k+c++rw ++l BGIOSGA028769-PA 14 KTPWTQEEDEALRRAVREHRRQNWAEIALALP-RRGPKSCRLRWCQHL 60 579*****************************.***********9986 PP | |||||||
2 | Myb_DNA-binding | 47.2 | 5.1e-15 | 68 | 109 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +T+eEd +++ + +G++ W+tIar+++ gR+++ +k+rw++ BGIOSGA028769-PA 68 VFTAEEDAIILAQQRVHGNK-WATIARCLP-GRSDNAVKNRWNS 109 59******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 22.189 | 9 | 64 | IPR017930 | Myb domain |
SMART | SM00717 | 2.4E-15 | 13 | 62 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.12E-28 | 13 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.1E-14 | 14 | 60 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 7.11E-14 | 16 | 60 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-21 | 16 | 67 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.8E-12 | 65 | 113 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 16.832 | 67 | 115 | IPR017930 | Myb domain |
Pfam | PF00249 | 9.6E-12 | 68 | 109 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-19 | 68 | 113 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.88E-10 | 69 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 200 aa Download sequence Send to blast |
MAADGGDGGG GGRKTPWTQE EDEALRRAVR EHRRQNWAEI ALALPRRGPK SCRLRWCQHL 60 SPELDSRVFT AEEDAIILAQ QRVHGNKWAT IARCLPGRSD NAVKNRWNSA LRKLLQVQHA 120 RGAGSPPTAA AAAAGDDRDD APVCLQLFPA RAGGVKEAGL FAGEKDVEEE DVATSLTLGL 180 PVLCEAELEL RLGPAWPATA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3zqc_A | 3e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_D | 3e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_G | 3e-27 | 14 | 118 | 2 | 106 | MYB3 |
3zqc_J | 3e-27 | 14 | 118 | 2 | 106 | MYB3 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in leaves from the third leaf to rosette leaves from six-week old plants. Expression follows a development-dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems and flowers. Expressed in dry seeds (PubMed:9678577). Expressed in root vasculature, root tips and lateral root (PubMed:17675404). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP012616 | 0.0 | CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649306.1 | 1e-139 | transcription factor MYB77 | ||||
Swissprot | Q9SN12 | 2e-34 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A2YVS9 | 1e-140 | A2YVS9_ORYSI; Uncharacterized protein | ||||
STRING | ONIVA08G18260.1 | 1e-141 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP4960 | 34 | 65 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 8e-37 | myb domain protein 77 |
Publications ? help Back to Top | |||
---|---|---|---|
|