PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA026097-PA | ||||||||
Common Name | OsI_26795 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 249aa MW: 28272.7 Da PI: 9.2925 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 98.6 | 2.6e-31 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rienk+nrqvtfskRrng+lKKA+E+SvLCda+va+i+fs++gklye+ss BGIOSGA026097-PA 10 RIENKINRQVTFSKRRNGLLKKAHEISVLCDADVALIVFSTKGKLYEFSS 59 8***********************************************96 PP | |||||||
2 | K-box | 90.8 | 2.4e-30 | 84 | 172 | 10 | 98 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 +++++e++ e+ Lk++++ Lq++qR+llGe+L++L+ keLqqLe+qLe slk+iRskKn+ll+e+i+elqkkek+l+++n+ L+k + BGIOSGA026097-PA 84 NTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTTKELQQLEHQLEYSLKHIRSKKNQLLFESISELQKKEKSLKNQNNVLQKLM 172 467789*****************************************************************************998755 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.085 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.3E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.50E-43 | 2 | 74 | No hit | No description |
SuperFamily | SSF55455 | 1.16E-33 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.2E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.2E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 1.8E-27 | 85 | 171 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.045 | 88 | 179 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
GO:0010154 | Biological Process | fruit development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 249 aa Download sequence Send to blast |
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAHEISVLCD ADVALIVFST KGKLYEFSSH 60 SSMEGILERY QRYSFDERAV LEPNTEDQEN WGDEYGILKS KLDALQKSQR QLLGEQLDTL 120 TTKELQQLEH QLEYSLKHIR SKKNQLLFES ISELQKKEKS LKNQNNVLQK LMETEKEKNN 180 AIINTNREEQ NGATPSTSSP TPVTAPDPIP TTNNSQSQPR GSGESEAQPS PAQAGNSKLP 240 PWMLRTSHT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 9e-21 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_A | 1e-20 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_B | 1e-20 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_C | 1e-20 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
6bz1_D | 1e-20 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.4573 | 0.0 | flower| panicle| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32974722 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Not expressed at early stages of plant development. First detected in leaves 4 weeks after germination, and expression levels are increased when the plant reaches the reproductive stage. {ECO:0000269|PubMed:15299121}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:10814814}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. Transcripts accumulate to higher levels in organs that retain meristematic characteristics: in the apical meristem and in the meristematic leaf primordia formed on its flank; in the developing panicle at the early stage of rachis-branch primordia differentiation; in the procambium of the rachis branches and in all floral organ primordia. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. | |||||
UniProt | Probable transcription factor that may promote floral transition phase and differentiation program of the vegetative shoot. {ECO:0000269|PubMed:11971906, ECO:0000269|PubMed:15299121}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF091458 | 0.0 | AF091458.1 Oryza sativa MADS box transcription factor MADS18 (MADS18) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015647484.1 | 0.0 | MADS-box transcription factor 18 isoform X2 | ||||
Swissprot | A2YNI2 | 0.0 | MAD18_ORYSI; MADS-box transcription factor 18 | ||||
Swissprot | Q0D4T4 | 0.0 | MAD18_ORYSJ; MADS-box transcription factor 18 | ||||
TrEMBL | A0A0E0AMF6 | 0.0 | A0A0E0AMF6_9ORYZ; Uncharacterized protein | ||||
TrEMBL | B8B8B3 | 0.0 | B8B8B3_ORYSI; Uncharacterized protein | ||||
STRING | OS07T0605200-01 | 0.0 | (Oryza sativa) | ||||
STRING | ORGLA07G0222800.1 | 0.0 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1151 | 37 | 113 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60910.1 | 4e-80 | AGAMOUS-like 8 |