PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA022168-PA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 181aa MW: 20669.3 Da PI: 10.3123 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 56.9 | 4.6e-18 | 15 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd+llv+++ + G g+W++ ++ g++R++k+c++rw +yl BGIOSGA022168-PA 15 KGPWTPEEDKLLVEYIGKNGHGSWRRLPKLAGLNRCGKSCRLRWTNYL 62 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 49.8 | 7.7e-16 | 68 | 113 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ +E+ l++++++ lG++ W++Ia ++ gRt++++k++w+++l BGIOSGA022168-PA 68 RGGFSDDEERLIIHLHATLGNK-WSSIATKLK-GRTDNEIKNYWNTHL 113 7889******************.********9.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 3.4E-24 | 7 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.15 | 10 | 62 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.93E-30 | 12 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.1E-14 | 14 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.2E-17 | 15 | 62 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.49E-11 | 17 | 62 | No hit | No description |
PROSITE profile | PS51294 | 25.785 | 63 | 117 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-25 | 66 | 117 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 1.1E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.1E-14 | 68 | 113 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.87E-11 | 71 | 113 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MGRSPCCEQD ADVKKGPWTP EEDKLLVEYI GKNGHGSWRR LPKLAGLNRC GKSCRLRWTN 60 YLRPDIKRGG FSDDEERLII HLHATLGNKW SSIATKLKGR TDNEIKNYWN THLRKKLLSQ 120 GIXXXXXXXX XXXXXXXXXX HNKHTTPRAN AYRSKPVATY IDNMLKQAGP CSLLLSVGCM 180 S |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 5e-28 | 12 | 117 | 4 | 108 | B-MYB |
1h8a_C | 5e-28 | 10 | 117 | 22 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 115465991 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Specifically and transiently expressed in root endodermal cells overlying the early stages of lateral root primordia formation. {ECO:0000269|PubMed:24902892, ECO:0000269|PubMed:25482809}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AF474134 | 1e-147 | AF474134.1 Oryza sativa typical P-type R2R3 Myb protein gene, partial cds. | |||
GenBank | AP001552 | 1e-147 | AP001552.1 Oryza sativa Japonica Group geneomic DNA, chromosome 6, PAC clone:P0029D06. | |||
GenBank | AP014962 | 1e-147 | AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence. | |||
GenBank | AY459342 | 1e-147 | AY459342.1 Oryza sativa (japonica cultivar-group) clone CLC13210-1 R2R3-MYB gene region. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015641987.1 | 2e-85 | transcription factor MYB53 | ||||
Swissprot | Q9S9Z2 | 5e-65 | MYB93_ARATH; Transcription factor MYB93 | ||||
TrEMBL | A0A0E0A411 | 1e-84 | A0A0E0A411_9ORYZ; Uncharacterized protein | ||||
TrEMBL | Q8S3Y4 | 1e-85 | Q8S3Y4_ORYSA; Typical P-type R2R3 Myb protein (Fragment) | ||||
STRING | OGLUM06G00580.1 | 2e-85 | (Oryza glumipatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5529 | 31 | 58 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G34670.1 | 2e-67 | myb domain protein 93 |
Publications ? help Back to Top | |||
---|---|---|---|
|