PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA014649-PA
Common NameOsI_16785
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 376aa    MW: 42920.6 Da    PI: 6.6123
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA014649-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-55521811129
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeelv++yL+kkv+ kk++l +vik++d+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  BGIOSGA014649-PA  52 VPPGFRFHPTDEELVDYYLRKKVALKKIDL-DVIKDIDLYKIEPWDLQEqcKIGNeEQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDK 143
                       69****************************.9***************952444442555********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                       ++++ k+ lvg++ktLvfy+grap+g+k+dW+mheyrle
  BGIOSGA014649-PA 144 PIYV-KNCLVGMRKTLVFYRGRAPNGQKSDWIMHEYRLE 181
                       ****.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-6048201IPR003441NAC domain
PROSITE profilePS5100559.22552201IPR003441NAC domain
PfamPF023653.5E-2853180IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MEVEARIHLL LIKLVFYRSA EERESASVHI NLLPVRELYF DPRKKMDAFS HVPPGFRFHP  60
TDEELVDYYL RKKVALKKID LDVIKDIDLY KIEPWDLQEQ CKIGNEEQNE WYFFSHKDKK  120
YPTGTRTNRA TTAGFWKATG RDKPIYVKNC LVGMRKTLVF YRGRAPNGQK SDWIMHEYRL  180
ETNEYGAPQE EGWVVCRVFK KRVAAVQRAA GDGGDSPFWF NEHVAFMAPA PGLDSPYHGH  240
RQSHPCKLEV EYHHHLLPQE AAPFMHLPRL ESPKLPAADI IVATAASSAL QPCGHTTAQQ  300
LQLQIEPVYV TADASAADWR DLDKLVASQF GHGDSTAKEP SYCNPVQVFQ VEGKQEDSLD  360
YVSTSASCGG EEDLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-49432024169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.561730.0panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329947610.0
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element formation. Expressed preferentially in procambial cells adjacent to root meristem. {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
UniprotTISSUE SPECIFICITY: Expressed in root, shoot and hypocotyl vascular elements, columella root caps, epidermal and cortex root cells and root-hypocotyl junctions. Observed predominantly in root imature xylem vessels (PubMed:18445131). Present in root developing xylems (PubMed:16103214, PubMed:17565617). Specifically expressed in vessels in the secondary xylem of the root-hypocotyl region, and in vessels but not in interfascicular fibers in stems (PubMed:25148240). {ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:17565617, ECO:0000269|PubMed:18445131, ECO:0000269|PubMed:25148240}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:16103214, PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:16103214, ECO:0000269|PubMed:25148240}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6340750.0JN634075.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634595.10.0NAC domain-containing protein 7
SwissprotQ9FWX21e-118NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA2XVW80.0A2XVW8_ORYSI; Uncharacterized protein
TrEMBLQ7F9T10.0Q7F9T1_ORYSJ; OSJNBb0020O11.1 protein
STRINGOGLUM04G19900.10.0(Oryza glumipatula)
STRINGORUFI04G21580.10.0(Oryza rufipogon)
STRINGOBART04G20020.10.0(Oryza barthii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-97NAC 007
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]