PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA010658-PA
Common NameOsI_11755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 361aa    MW: 38391 Da    PI: 6.5726
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA010658-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  BGIOSGA010658-PA 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                      788*******************************************97 PP

2Myb_DNA-binding53.94.1e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  BGIOSGA010658-PA  67 RGTFSQEEEDLIIQLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                       899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129419.139961IPR017930Myb domain
SuperFamilySSF466894.49E-3012108IPR009057Homeodomain-like
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001678.96E-121761No hitNo description
PROSITE profilePS5129427.23862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PfamPF002493.9E-1667111IPR001005SANT/Myb domain
CDDcd001672.01E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRDRG  120
IDPATHKPLA ADSSATPTNT TAAAASRSTA TCRAVFSDAE LQIPTAAAVQ QQQQAPLVGA  180
MQLVDGIKMP LDDYWPAAAA PSSSTTTFSA YHHALSMQQQ AAAGCGGAAA FDMDALSHCG  240
VVVAPSASSS STLTSMAGLS PAAADAAEQS ANVAAAAATT TNLPWLDLGH ANPIATMDHY  300
AGVLDELRWS DYFDGAYQAA TTATQGGALQ GQCLYDGGGG GGKDVDDAVQ FVDVHSLSNW  360
C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
1h8a_C2e-291111624128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126110.0CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879543.10.0transcription factor MYB4
TrEMBLB8AQ840.0B8AQ84_ORYSI; Uncharacterized protein
STRINGOGLUM03G19500.10.0(Oryza glumipatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G57560.12e-75myb domain protein 50