PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA010547-PA | ||||||||
Common Name | OsI_12002 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9138.59 Da PI: 10.115 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 43.1 | 9.9e-14 | 2 | 42 | 8 | 48 |
HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 Ed++lv +++++G g W + +++ g++R++k+c++rw++yl BGIOSGA010547-PA 2 EDDILVSYIAKHGEGKWGALPKRAGLKRCGKSCRLRWLNYL 42 9***************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 2.2E-4 | 1 | 44 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.025 | 1 | 46 | IPR017930 | Myb domain |
CDD | cd00167 | 9.38E-9 | 2 | 42 | No hit | No description |
SuperFamily | SSF46689 | 3.86E-18 | 2 | 69 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.0E-16 | 2 | 45 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 3.7E-12 | 2 | 42 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-6 | 46 | 69 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MEDDILVSYI AKHGEGKWGA LPKRAGLKRC GKSCRLRWLN YLRPGIKRGN ISGDEEELIL 60 RLHTLLGNRP VSDPLLSSSP AN |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | D88619 | 1e-111 | D88619.1 Oryza sativa mRNA for OSMYB3, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015629423.1 | 4e-42 | anthocyanin regulatory C1 protein | ||||
Swissprot | Q9FJA2 | 2e-33 | TT2_ARATH; Transcription factor TT2 | ||||
TrEMBL | A2XHV9 | 4e-52 | A2XHV9_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q75K44 | 4e-52 | Q75K44_ORYSJ; Myb-like protein | ||||
STRING | ORUFI03G21780.1 | 2e-52 | (Oryza rufipogon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP116 | 37 | 448 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G35550.1 | 1e-35 | MYB family protein |