PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA010547-PA
Common NameOsI_12002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 82aa    MW: 9138.59 Da    PI: 10.115
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA010547-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-14242848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      Ed++lv +++++G g W + +++ g++R++k+c++rw++yl
  BGIOSGA010547-PA  2 EDDILVSYIAKHGEGKWGALPKRAGLKRCGKSCRLRWLNYL 42
                      9***************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.2E-4144IPR001005SANT/Myb domain
PROSITE profilePS5129419.025146IPR017930Myb domain
CDDcd001679.38E-9242No hitNo description
SuperFamilySSF466893.86E-18269IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-16245IPR009057Homeodomain-like
PfamPF002493.7E-12242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-64669IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MEDDILVSYI AKHGEGKWGA LPKRAGLKRC GKSCRLRWLN YLRPGIKRGN ISGDEEELIL  60
RLHTLLGNRP VSDPLLSSSP AN
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis.
UniprotTISSUE SPECIFICITY: Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems.
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankD886191e-111D88619.1 Oryza sativa mRNA for OSMYB3, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629423.14e-42anthocyanin regulatory C1 protein
SwissprotQ9FJA22e-33TT2_ARATH; Transcription factor TT2
TrEMBLA2XHV94e-52A2XHV9_ORYSI; Uncharacterized protein
TrEMBLQ75K444e-52Q75K44_ORYSJ; Myb-like protein
STRINGORUFI03G21780.12e-52(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.11e-35MYB family protein
Publications ? help Back to Top
  1. Coego A, et al.
    The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression.
    Plant J., 2014. 77(6): p. 944-53
    [PMID:24456507]
  2. Liu C,Jun JH,Dixon RA
    MYB5 and MYB14 Play Pivotal Roles in Seed Coat Polymer Biosynthesis in Medicago truncatula.
    Plant Physiol., 2014. 165(4): p. 1424-1439
    [PMID:24948832]
  3. Zhu Z, et al.
    Characterization of the cis elements in the proximal promoter regions of the anthocyanin pathway genes reveals a common regulatory logic that governs pathway regulation.
    J. Exp. Bot., 2015. 66(13): p. 3775-89
    [PMID:25911741]
  4. Liu Y,Shi Z,Maximova SN,Payne MJ,Guiltinan MJ
    Tc-MYBPA an Arabidopsis TT2-like transcription factor and functions in the regulation of proanthocyanidin synthesis in Theobroma cacao.
    BMC Plant Biol., 2015. 15: p. 160
    [PMID:26109181]
  5. Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
    The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors.
    Plant Physiol. Biochem., 2016. 102: p. 70-9
    [PMID:26913794]
  6. Li Y, et al.
    Two IIIf Clade-bHLHs from Freesia hybrida Play Divergent Roles in Flavonoid Biosynthesis and Trichome Formation when Ectopically Expressed in Arabidopsis.
    Sci Rep, 2016. 6: p. 30514
    [PMID:27465838]
  7. Li C,Zhang B,Chen B,Ji L,Yu H
    Site-specific phosphorylation of TRANSPARENT TESTA GLABRA1 mediates carbon partitioning in Arabidopsis seeds.
    Nat Commun, 2018. 9(1): p. 571
    [PMID:29422671]