PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA008494-PA | ||||||||
Common Name | OsI_07801 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 235aa MW: 26856.4 Da PI: 9.4759 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 88.1 | 4.7e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss BGIOSGA008494-PA 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59 8***********************************************96 PP | |||||||
2 | K-box | 94.6 | 1.6e-31 | 75 | 170 | 3 | 98 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 +++ +++ +++ + +q+e+a L+++++nLq+++R+l+GedL+ L++keLq+Le+qLe sl+++R+kK+++l+++i+el +k +++en++L BGIOSGA008494-PA 75 EQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELY 167 56777789999********************************************************************************** PP K-box 96 kkl 98 kk+ BGIOSGA008494-PA 168 KKI 170 *98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.2E-39 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.651 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.03E-32 | 2 | 91 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.39E-44 | 2 | 77 | No hit | No description |
PRINTS | PR00404 | 1.5E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF01486 | 8.7E-30 | 83 | 170 | IPR002487 | Transcription factor, K-box |
PROSITE profile | PS51297 | 16.394 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010440 | Biological Process | stomatal lineage progression | ||||
GO:0048574 | Biological Process | long-day photoperiodism, flowering | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008134 | Molecular Function | transcription factor binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 235 aa Download sequence Send to blast |
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST 60 SMKSVIDRYG KSKDEQQAVA NPNSELKFWQ REAASLRQQL HNLQENHRQL MGEDLSGLNV 120 KELQSLENQL EISLRSVRTK KDHVLIDEIH ELNRKGSLVH QENMELYKKI SLIRQENAEL 180 YKKIYETEGP SEVNRDSPTP YNFAVIEKTN VPVQLGLSTL PQHSDAEQST APKLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 83 | 1 | 83 | MEF2C |
5f28_B | 4e-20 | 1 | 83 | 1 | 83 | MEF2C |
5f28_C | 4e-20 | 1 | 83 | 1 | 83 | MEF2C |
5f28_D | 4e-20 | 1 | 83 | 1 | 83 | MEF2C |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.49762 | 0.0 | root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 116638674 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14701936}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00410 | DAP | Transfer from AT3G57230 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT835409 | 0.0 | CT835409.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA125M19, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015626695.1 | 1e-174 | MADS-box transcription factor 27 | ||||
Swissprot | Q6EP49 | 1e-175 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
TrEMBL | A0A0D3F6V1 | 1e-173 | A0A0D3F6V1_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0CMG2 | 1e-173 | A0A0E0CMG2_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0NGW0 | 1e-173 | A0A0E0NGW0_ORYRU; Uncharacterized protein | ||||
TrEMBL | B8AED3 | 1e-173 | B8AED3_ORYSI; Uncharacterized protein | ||||
TrEMBL | B9F0Q9 | 1e-173 | B9F0Q9_ORYSJ; Uncharacterized protein | ||||
STRING | OMERI02G20560.1 | 1e-173 | (Oryza meridionalis) | ||||
STRING | ORUFI02G22950.1 | 1e-173 | (Oryza rufipogon) | ||||
STRING | OS02T0579600-00 | 1e-173 | (Oryza sativa) | ||||
STRING | OBART02G21870.1 | 1e-173 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP614 | 35 | 130 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G57230.1 | 1e-102 | AGAMOUS-like 16 |
Publications ? help Back to Top | |||
---|---|---|---|
|