PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

BGIOSGA007333-PA

Common Name

OsI_05477

Organism

Oryza sativa subsp. indica

Taxonomic ID

39946

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa

Family

MIKC_MADS

Protein Properties

Length: 265aa MW: 29720.6 Da PI: 7.4106

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
BGIOSGA007333-PA	genome	RIS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	86.4	1.6e-27	50	99	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+ly ++s BGIOSGA007333-PA 50 RIEDPTSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYQFAS 99 8***********************************************86 PP
2	K-box	74.5	3e-25	118	213	4	99
K-box 4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 ss + ee+ ++++ e++ L k+ie ++ + +llGe+L+s+s++eLq+Le qLeksl ++R+kK+++l++qi el++ke +l +en+ Lr BGIOSGA007333-PA 118 SSAHEGEESCVQKWRSEATTLGKKIEAIEGYKSKLLGEGLGSCSVQELQELEVQLEKSLCSVRQKKQKMLMDQILELREKEMNLLKENMVLRD 210 44444788899*********************************************************************************9 PP K-box 97 kle 99 + + BGIOSGA007333-PA 211 QCK 213 876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
CDD	cd00265	2.84E-34	32	118	No hit	No description
SMART	SM00432	2.8E-35	41	100	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.632	41	101	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-28	43	63	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-29	43	119	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	43	97	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.5E-26	50	97	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-28	63	78	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.5E-28	78	99	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	4.0E-25	125	212	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	13.79	128	218	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 265 aa Download sequence Send to blast
MAAAAAGMGG GGGVQQQETT TTVVQVAAEA SRKKVEVRSA GRRGRREMRR IEDPTSRQVT 60 FSKRRSGLLK KAFELSVLCD AEVALIVFSP RGRLYQFASA SSDLQRTIDR YLNHTKNSSA 120 HEGEESCVQK WRSEATTLGK KIEAIEGYKS KLLGEGLGSC SVQELQELEV QLEKSLCSVR 180 QKKQKMLMDQ ILELREKEMN LLKENMVLRD QCKALSSPWS TSVGELKNKQ ADDDVHRHED 240 YSGGGVRDDD DRRMMEDVET DLIYD

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
1tqe_R	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
1tqe_S	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_A	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_B	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_C	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_D	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_E	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
6c9l_F	2e-18	43	123	3	78	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Os.75139	1e-108	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Low expression in the young panicle continues to decline as the organ mature. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.
Uniprot	TISSUE SPECIFICITY: Expressed in mature leaves and at low levels in roots and young panicles. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP004049	1e-164	AP004049.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1212_C06.
GenBank	AP006720	1e-164	AP006720.1 Oryza sativa Japonica Group genomic DNA, chromosome 2, clone:OJA1212_C06.
GenBank	AP014958	1e-164	AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015625202.1	1e-162	MADS-box protein SOC1 isoform X1
Swissprot	Q9XJ60	3e-67	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	B8AGW1	0.0	B8AGW1_ORYSI; Uncharacterized protein
STRING	ONIVA02G00370.2	0.0	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1413	33	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G45660.1	2e-48	AGAMOUS-like 20

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]