PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA005178-PA | ||||||||
Common Name | OsI_05220 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 181aa MW: 19814.3 Da PI: 5.0131 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 45.1 | 1.8e-14 | 70 | 122 | 1 | 55 |
CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 r+ +hn+ Er RR+++N+ ++ Lr llP a + kKls +++ ++ +YI +Lq BGIOSGA005178-PA 70 RKLSHNAYERDRRKQLNELYSSLRALLPDA--DHTKKLSIPTTVSRVLKYIPELQ 122 6889*************************7..35666***************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47459 | 1.83E-16 | 67 | 137 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
CDD | cd00083 | 1.75E-12 | 69 | 126 | No hit | No description |
PROSITE profile | PS50888 | 13.954 | 69 | 121 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 4.8E-13 | 70 | 137 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 1.2E-11 | 70 | 122 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SMART | SM00353 | 8.4E-10 | 75 | 127 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MEQLFVDDPA FASSMSSLEA DIFSGAGQLP SSPWLDLDHL DDDVQDLSMA PTTANTVSSG 60 YGSGGSGSHR KLSHNAYERD RRKQLNELYS SLRALLPDAD HTKKLSIPTT VSRVLKYIPE 120 LQKQVENLER KKKELTATST TNCKPGVLGN QMMSEGMAPI VSATCINDME IMVQNPDRPS 180 V |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.21893 | 0.0 | callus| leaf| root| seed| stem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 32983408 | 0.0 |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the DNA motif 5'-CACGTGG-3' in the promoter of iron (Fe) deficiency-inducible genes as well as of genes involved in iron homeostasis, thus contributing to basal tolerance to iron deficiency, iron uptake from soil and iron transport, particularly during seed maturation and germination. Promotes the accumulation of mugineic acid family phytosiderophores (MAs). Required for ethylene-mediated signaling during iron deficiency responses. Improves growth and yield, especially in calcareous soil with low iron availability. Promotes iron concentration in shoots and grain. {ECO:0000250|UniProtKB:Q0JFZ0}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CT833597 | 0.0 | CT833597.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA113H03, full insert sequence. | |||
GenBank | CT833598 | 0.0 | CT833598.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA042K05, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612709.1 | 1e-99 | protein IRON-RELATED TRANSCRIPTION FACTOR 2 isoform X1 | ||||
Refseq | XP_025878269.1 | 1e-100 | protein IRON-RELATED TRANSCRIPTION FACTOR 2 isoform X2 | ||||
Swissprot | A2WZ60 | 1e-100 | IRO2_ORYSI; Protein IRON-RELATED TRANSCRIPTION FACTOR 2 | ||||
TrEMBL | B8A978 | 1e-132 | B8A978_ORYSI; Uncharacterized protein | ||||
STRING | ORUFI01G47560.1 | 1e-125 | (Oryza rufipogon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3280 | 34 | 72 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56970.1 | 6e-26 | bHLH family protein |