PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA001461-PA
Common NameOsI_02337
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 360aa    MW: 38999.2 Da    PI: 5.9441
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA001461-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.5e-161764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg W++eEde+l + + ++G g+W+++++  g+ R++k+c++rw +yl
  BGIOSGA001461-PA 17 RGLWSPEEDEKLFNHISRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 64
                      788*******************************************97 PP

2Myb_DNA-binding51.52.3e-1670113146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+++++E+el++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  BGIOSGA001461-PA  70 RGSFSQQEEELIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 113
                       899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-24967IPR009057Homeodomain-like
PROSITE profilePS5129418.8451264IPR017930Myb domain
SuperFamilySSF466892.25E-2914111IPR009057Homeodomain-like
SMARTSM007173.0E-131666IPR001005SANT/Myb domain
PfamPF002492.2E-141764IPR001005SANT/Myb domain
CDDcd001678.06E-122064No hitNo description
PROSITE profilePS5129425.97265119IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2668119IPR009057Homeodomain-like
SMARTSM007175.4E-1669117IPR001005SANT/Myb domain
PfamPF002491.0E-1470114IPR001005SANT/Myb domain
CDDcd001671.43E-1172112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRESVAACS PKPKLRRGLW SPEEDEKLFN HISRYGVGCW SSVPKLAGLE RCGKSCRLRW  60
INYLRPDLKR GSFSQQEEEL IISLHKILGN RWSQIASQLP GRTDNEIKNF WNSCLKKKLR  120
QRGIDPATHK PLNDGGAGAE EEHHDDGDKQ QQQQLMDDVD DCFAIGGGGS SDSLAPPHSP  180
AVSFDPLSVT NVPTTMMQSS SSPYGAAGGE HSSFRSDTLC DYGGSGGGVD VVSDAGTYSA  240
YTGDSSSNSN STAWTCSSVV VGGAGELPPP PLLPHMDMFG RVDAEPPPYP PFDVPARFSP  300
WHHHHHHHHE PTLPTPPQRL DGGGGAAASF PIRSLSRDMP ESCFDLGRGA LDDEFGVDFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31131193108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1114120LKKKLRQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101150.0panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977200820.0
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Germinating seed and apical meristem of shoot and root.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643158.10.0myb-related protein Hv33
SwissprotP200279e-74MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0E0FMV70.0A0A0E0FMV7_ORYNI; Uncharacterized protein
TrEMBLA2WR510.0A2WR51_ORYSI; Uncharacterized protein
STRINGONIVA01G21360.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-75myb domain protein 86