PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | BGIOSGA000472-PA | ||||||||
Common Name | OsI_04470 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 299aa MW: 33024.2 Da PI: 7.3015 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 25.3 | 3.6e-08 | 31 | 77 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47 +W++eE + + +a +q + +W+ +a++++ ++t +++++++++ BGIOSGA000472-PA 31 AWSAEENKVFERALAQVDLDspnRWEMVAAMLP-RKTVIDVVNHYRDL 77 7****************99999***********.***********986 PP | |||||||
2 | Myb_DNA-binding | 44.3 | 4e-14 | 138 | 182 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+eE++ ++ + k++G g+W+ I+r++ + Rt+ q+ s+ qky BGIOSGA000472-PA 138 PWTEEEHKSFLMGLKKYGRGDWRNISRYFVTSRTPTQVASHAQKY 182 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.1E-4 | 21 | 77 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 6.596 | 27 | 81 | IPR017884 | SANT domain |
SMART | SM00717 | 3.5E-7 | 28 | 80 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 2.07E-10 | 31 | 85 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 6.80E-7 | 31 | 77 | No hit | No description |
PROSITE profile | PS51294 | 16.496 | 131 | 187 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 9.66E-18 | 133 | 187 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.6E-17 | 134 | 185 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.6E-12 | 135 | 185 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-11 | 135 | 181 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 1.6E-11 | 138 | 182 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.42E-10 | 138 | 183 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 299 aa Download sequence Send to blast |
MMAEALREVL PLPYFPGQPC WYLQERRGAE AWSAEENKVF ERALAQVDLD SPNRWEMVAA 60 MLPRKTVIDV VNHYRDLEND VGSIEAGLVP FPHYSSSLSP ASSGFTLQDW DGSDGGFRRG 120 CYLKRGRAPD QERKKGVPWT EEEHKSFLMG LKKYGRGDWR NISRYFVTSR TPTQVASHAQ 180 KYFIRLNSGG KDKRRSSIHD ITTVNLPEED TSNPSPSPPS VLTTASDQLG SLVDTKPVPP 240 PPSLGAQRHF MSPLPGALGV SHHPYGNVKL EPNASFLAGG GTGPGLDDAI LLQMQCGHL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 8e-14 | 26 | 97 | 5 | 76 | RADIALIS |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Os.42406 | 0.0 | panicle| stem| vegetative meristem |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 37988651 | 0.0 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | FJ940214 | 0.0 | FJ940214.1 Oryza sativa Japonica Group clone KCS611H03 Myb transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015621447.1 | 0.0 | transcription factor DIVARICATA | ||||
Swissprot | Q8S9H7 | 7e-77 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0D3EWD3 | 0.0 | A0A0D3EWD3_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0D9YHF3 | 0.0 | A0A0D9YHF3_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0CAF7 | 0.0 | A0A0E0CAF7_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0FVW7 | 0.0 | A0A0E0FVW7_ORYNI; Uncharacterized protein | ||||
TrEMBL | A0A0E0N544 | 0.0 | A0A0E0N544_ORYRU; Uncharacterized protein | ||||
TrEMBL | A2WX32 | 0.0 | A2WX32_ORYSI; Uncharacterized protein | ||||
TrEMBL | I1NTF4 | 0.0 | I1NTF4_ORYGL; Uncharacterized protein | ||||
STRING | OGLUM01G41520.1 | 0.0 | (Oryza glumipatula) | ||||
STRING | OMERI01G34080.1 | 0.0 | (Oryza meridionalis) | ||||
STRING | ORUFI01G40950.1 | 0.0 | (Oryza rufipogon) | ||||
STRING | ONIVA01G42500.1 | 0.0 | (Oryza nivara) | ||||
STRING | ORGLA01G0314400.1 | 0.0 | (Oryza glaberrima) | ||||
STRING | OBART01G37590.1 | 0.0 | (Oryza barthii) | ||||
STRING | OBART01G37610.1 | 0.0 | (Oryza barthii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2274 | 37 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G38090.1 | 1e-79 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|