PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORUFI08G24040.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 176aa MW: 19857.8 Da PI: 8.9469 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 96.4 | 1.2e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fs+ g+lye++s ORUFI08G24040.5 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALLVFSPAGRLYEFAS 59 79***********************************************86 PP | |||||||
2 | K-box | 17.4 | 1.9e-07 | 121 | 163 | 43 | 85 |
K-box 43 LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 +++L++ eL+ Le+++ ++l+ +++k + + + + ++ kk k ORUFI08G24040.5 121 VNELNIAELRGLEEAMTNALTVVKNKLMMQVASVLPQSEKKRK 163 799********************99988888877777777765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.6E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.039 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.63E-31 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.34E-38 | 2 | 71 | No hit | No description |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 6.7E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALLVFSP AGRLYEFASS 60 TSSIDTIFGR YWDLLDTTID LNIEARESRV DCNIQLRQKE RSDDPVPKIN HITQCVLESN 120 VNELNIAELR GLEEAMTNAL TVVKNKLMMQ VASVLPQSEK KRKSCSISEP RSGVSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 1 | 94 | 1 | 84 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts redundantly with EJ2 to control meristem maturation and inflorescence architecture. {ECO:0000269|PubMed:28528644}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242980 | 0.0 | AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649438.1 | 1e-115 | MADS-box transcription factor 51-like isoform X2 | ||||
Swissprot | K4DEK0 | 6e-36 | J2_SOLLC; MADS-box protein J2 | ||||
TrEMBL | A0A0E0QLM3 | 1e-126 | A0A0E0QLM3_ORYRU; Uncharacterized protein | ||||
STRING | OS08T0531900-01 | 1e-115 | (Oryza sativa) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 5e-39 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|