PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ORUFI08G24040.4

Organism

Oryza rufipogon

Taxonomic ID

4529

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MIKC_MADS

Protein Properties

Length: 321aa MW: 36436.8 Da PI: 8.9348

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ORUFI08G24040.4	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	99.2	1.6e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s ORUFI08G24040.4 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59 79***********************************************96 PP
2	K-box	72.4	1.4e-24	70	143	26	100
K-box 26 keienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 k+++++++ R+llGedL+sL +keL++Le+qL++slk++R++++++l++ + elq++e++++e+n++Lr+klee ORUFI08G24040.4 70 KQLSKIEK-VRNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTRTKHLVDRLTELQRREQMVSEANRCLRRKLEE 143 34455555.5**************************************************************987 PP
3	K-box	38.2	6.1e-14	193	226	36	69
K-box 36 RhllGedLesLslkeLqqLeqqLekslkkiRskK 69 +llGedL+sL +keL++Le+qL++slk++R+++ ORUFI08G24040.4 193 GNLLGEDLDSLGIKELESLEKQLDSSLKHVRTTR 226 49*****************************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.389	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.3E-41	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-30	2	79	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.66E-38	2	65	No hit	No description
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.5E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-32	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	11.295	55	147	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.1E-17	77	141	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	6.781	171	279	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.4E-9	194	234	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0016021	Cellular Component	integral component of membrane
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 321 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST 60 QRNAVTQDPK QLSKIEKVRN LLGEDLDSLG IKELESLEKQ LDSSLKHVRT TRTKHLVDRL 120 TELQRREQMV SEANRCLRRK LEESNHVRGQ QVWEQGCNLI GYERQPEVQQ PLHGGNGFFH 180 PLDAAGEPTL QIGNLLGEDL DSLGIKELES LEKQLDSSLK HVRTTRWILN SDETSRRPRS 240 PATLPPPVPT PLHDRAAAQQ QQQQLARRGD GEMEMVPLLL LPSTTFLFFE NGFPHHHIII 300 LASSTVLALL LVVLVLSSSP F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3mu6_A	1e-18	2	65	1	64	Myocyte-specific enhancer factor 2A
3mu6_B	1e-18	2	65	1	64	Myocyte-specific enhancer factor 2A
3mu6_C	1e-18	2	65	1	64	Myocyte-specific enhancer factor 2A
3mu6_D	1e-18	2	65	1	64	Myocyte-specific enhancer factor 2A
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK100263	0.0	AK100263.1 Oryza sativa Japonica Group cDNA clone:J023063L04, full insert sequence.
GenBank	AY551921	0.0	AY551921.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS216 mRNA, complete cds.
GenBank	FJ750934	0.0	FJ750934.1 Oryza sativa clone KCS054B01 MADS-box transcription factor 7 mRNA, complete cds.
GenBank	OSU31994	0.0	U31994.1 Oryza sativa MADS box protein OsMADS45 mRNA, complete cds.
GenBank	OSU78891	0.0	U78891.2 Oryza sativa MADS box protein (MADS7) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015648762.1	1e-118	MADS-box transcription factor 7
Swissprot	P0C5B0	1e-119	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	1e-119	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A0E0QLM2	0.0	A0A0E0QLM2_ORYRU; Uncharacterized protein
STRING	ORUFI08G24040.2	1e-172	(Oryza rufipogon)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.1	7e-60	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]