PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G17800.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 385aa    MW: 43306.7 Da    PI: 8.2696
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G17800.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.81.8e-52161431128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      l pGfrFhPtdeelv++yLk+k+++k++++ e i+++diyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s
  ORUFI08G17800.1  16 LLPGFRFHPTDEELVSFYLKRKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGEKEWYFYCPRDRKYRNSVRPNRVTAAGFWKATGTDRPIYS 108
                      579***************************.89***************9888999*************************************** PP

              NAM  95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      + +++ +glkk+Lvfykgra +g ktdW+mhe+rl
  ORUFI08G17800.1 109 TeGTKCIGLKKSLVFYKGRAARGIKTDWMMHEFRL 143
                      956667***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5715174IPR003441NAC domain
PROSITE profilePS5100556.86616174IPR003441NAC domain
PfamPF023658.1E-2618143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MEERNDVNMD KSDEILLPGF RFHPTDEELV SFYLKRKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGEK EWYFYCPRDR KYRNSVRPNR VTAAGFWKAT GTDRPIYSTE GTKCIGLKKS  120
LVFYKGRAAR GIKTDWMMHE FRLPTLTDPS LPKKPIDKNI PLNDSWTICR IFKKTSSMAQ  180
RALCQTWGAQ LPGTIDPDIF STLQSVQASQ FALESSSCSL QAAATAAHQI TSKYALQGNN  240
NNQQQQQQHK PSNPLDGSSC KVINFNCSQS AEVQNSQIIL PFEAHTSQKT ATPLLFDTQF  300
GQPDQISRFV VDSSVNANGG GISNKSQDPS ARKPGSGFSM NSDWDGVARI NFPFDLGADS  360
SEDWRSSIPW ESFLSPTTVH AEMPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-531617717168NO APICAL MERISTEM PROTEIN
1ut4_B2e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_A2e-531617717168NO APICAL MERISTEM PROTEIN
1ut7_B2e-531617717168NO APICAL MERISTEM PROTEIN
4dul_A2e-531617717168NAC domain-containing protein 19
4dul_B2e-531617717168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0730130.0AK073013.1 Oryza sativa Japonica Group cDNA clone:J033000B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649454.10.0protein FEZ
SwissprotQ9ZVH09e-98FEZ_ARATH; Protein FEZ
TrEMBLA0A0E0AVT00.0A0A0E0AVT0_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0ICB90.0A0A0E0ICB9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0QJG70.0A0A0E0QJG7_ORYRU; Uncharacterized protein
TrEMBLA2YVJ80.0A2YVJ8_ORYSI; Uncharacterized protein
STRINGOGLUM08G16650.10.0(Oryza glumipatula)
STRINGORUFI08G17800.10.0(Oryza rufipogon)
STRINGONIVA08G17120.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33663882
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-100NAC family protein
Publications ? help Back to Top
  1. Bennett T,van den Toorn A,Willemsen V,Scheres B
    Precise control of plant stem cell activity through parallel regulatory inputs.
    Development, 2014. 141(21): p. 4055-64
    [PMID:25256342]