PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | ORUFI04G20200.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 278aa MW: 30802.3 Da PI: 6.4017 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 164.1 | 5e-51 | 10 | 137 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGfrF P+deelv++yL kkv++++ + ++ evd++ ePw+Lp +k + +ewyfFs rd+kyatg+r+nratk+gyWkatgkd+ev s ORUFI04G20200.1 10 LPPGFRFYPSDEELVCHYLYKKVSNERASQ-GTLVEVDLHAREPWELPDVAKLTASEWYFFSFRDRKYATGSRTNRATKTGYWKATGKDREVRS 102 79*************************888.88***************77777889************************************** PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg++ktLvfy+grap+g+k+ Wvmhe+rl ORUFI04G20200.1 103 PaTRAVVGMRKTLVFYQGRAPNGVKSGWVMHEFRL 137 977788***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.26E-60 | 8 | 156 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 58.738 | 10 | 156 | IPR003441 | NAC domain |
Pfam | PF02365 | 4.3E-28 | 11 | 137 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 278 aa Download sequence Send to blast |
MGLREIESTL PPGFRFYPSD EELVCHYLYK KVSNERASQG TLVEVDLHAR EPWELPDVAK 60 LTASEWYFFS FRDRKYATGS RTNRATKTGY WKATGKDREV RSPATRAVVG MRKTLVFYQG 120 RAPNGVKSGW VMHEFRLDSP HSPPKEDWVL CRVFQKSKGD GEQDNPTSAA SPAATFAGSS 180 QAAVPGQAAY SSDDHTGSSM GFAPRQNEIL DSSSHQLLNL AMLQCNSVLD HFPQEVNSSP 240 MMGLAGSIGI GDEYGFFYDT GFEETASLGG MRFPQGWS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-50 | 1 | 156 | 4 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swm_B | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swm_C | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swm_D | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swp_A | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swp_B | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swp_C | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
3swp_D | 2e-50 | 1 | 156 | 7 | 168 | NAC domain-containing protein 19 |
4dul_A | 2e-50 | 1 | 156 | 4 | 165 | NAC domain-containing protein 19 |
4dul_B | 2e-50 | 1 | 156 | 4 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK062955 | 0.0 | AK062955.1 Oryza sativa Japonica Group cDNA clone:001-109-C12, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015634235.1 | 0.0 | protein CUP-SHAPED COTYLEDON 1 | ||||
Swissprot | Q9FRV4 | 8e-63 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
TrEMBL | A0A0D9ZN59 | 0.0 | A0A0D9ZN59_9ORYZ; Uncharacterized protein | ||||
TrEMBL | A0A0E0GXN1 | 0.0 | A0A0E0GXN1_ORYNI; Uncharacterized protein | ||||
TrEMBL | A0A0E0PBK5 | 0.0 | A0A0E0PBK5_ORYRU; Uncharacterized protein | ||||
TrEMBL | A2XVI6 | 0.0 | A2XVI6_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q7X7J4 | 0.0 | Q7X7J4_ORYSJ; NAC transcription factor | ||||
STRING | OGLUM04G18750.1 | 0.0 | (Oryza glumipatula) | ||||
STRING | ORUFI04G20200.1 | 0.0 | (Oryza rufipogon) | ||||
STRING | OS04T0515900-01 | 0.0 | (Oryza sativa) | ||||
STRING | ONIVA04G01950.1 | 0.0 | (Oryza nivara) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP697 | 38 | 166 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28530.1 | 6e-82 | NAC domain containing protein 74 |