PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G19580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 387aa    MW: 40775.7 Da    PI: 6.6351
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G19580.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  ORUFI03G19580.1 14 RGLWSPEEDEKLMNHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                     788*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129425.33965IPR017930Myb domain
SMARTSM007173.1E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-151461IPR001005SANT/Myb domain
SuperFamilySSF466893.99E-221690IPR009057Homeodomain-like
CDDcd001671.00E-111761No hitNo description
PROSITE profilePS500905.47162135IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.3E-1365139IPR009057Homeodomain-like
SMARTSM007170.1866137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MAKQSCCHKK KLRRGLWSPE EDEKLMNHIA KYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIQ LHSMLGNKYV LYSSSTHIGQ SLSRSVPSLT MAGAPPPPPA  120
TGGDNEVKNF WNSYIKKKLR DRGIDPATHK PLAADSSATP TNTTAAAASR STATCRAVFS  180
DAELQIPTAA AVQQQQQAPL VGAMQLVDGI KMPLDDYWPA AAAAAAPSSS TTTFSAYHHA  240
LSMQQQAAAG CGAAAAFDMD ALSHCGVVVA PSASSSSTLT SMAGLSPAAA DAAEQSANVA  300
AAAATTTNLP WLDLGHANPI ATMDHYAGVL DELRWSDYFD GAYQAATTAT QGGALQGQCL  360
YDGGGGGGKD VDDAVQFVDV HSLSNWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-201113924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0872200.0AC087220.9 Oryza sativa chromosome 3 BAC OSJNBb0097F01 genomic sequence, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025879543.10.0transcription factor MYB4
TrEMBLA0A0E0NVM10.0A0A0E0NVM1_ORYRU; Uncharacterized protein
STRINGORUFI03G19580.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.13e-62myb domain protein 86