PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | gw1.1.1011.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 119aa MW: 13729.6 Da PI: 10.4159 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 81 | 7.8e-26 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +ri +++nrqvtf+kR+ng++KKA ELSvLCd ++a++i+ s+ kly yss gw1.1.1011.1 9 ERIADERNRQVTFTKRKNGLMKKAMELSVLCDCDIALVIYNSHAKLYQYSS 59 699**********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-32 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.67E-30 | 1 | 73 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 28.034 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.06E-33 | 2 | 77 | No hit | No description |
PRINTS | PR00404 | 2.0E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.5E-24 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.0E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009553 | Biological Process | embryo sac development | ||||
GO:0010094 | Biological Process | specification of carpel identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048455 | Biological Process | stamen formation | ||||
GO:0048459 | Biological Process | floral whorl structural organization | ||||
GO:0048509 | Biological Process | regulation of meristem development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0080112 | Biological Process | seed growth | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MGRKKIKIER IADERNRQVT FTKRKNGLMK KAMELSVLCD CDIALVIYNS HAKLYQYSSG 60 NIEDVLRRFH TDCAEAHEVR NNQDLFDQHF SSQADTSARG KNAASTSKRR GNVWRRVAI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 9e-35 | 1 | 87 | 1 | 86 | MEF2 CHIMERA |
6byy_B | 9e-35 | 1 | 87 | 1 | 86 | MEF2 CHIMERA |
6byy_C | 9e-35 | 1 | 87 | 1 | 86 | MEF2 CHIMERA |
6byy_D | 9e-35 | 1 | 87 | 1 | 86 | MEF2 CHIMERA |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001415963.1 | 5e-66 | predicted protein | ||||
Swissprot | O55087 | 2e-33 | MEF2B_MOUSE; Myocyte-specific enhancer factor 2B | ||||
TrEMBL | A4RRU5 | 1e-64 | A4RRU5_OSTLU; Uncharacterized protein | ||||
STRING | ABO94255 | 2e-65 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP3656 | 13 | 14 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G09960.2 | 9e-26 | MIKC_MADS family protein |