PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.7.793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 335aa    MW: 36033 Da    PI: 4.6636
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.7.793.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.63.1e-17300331132
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                    C +Cgt kTp+WR gp+g+ktLCnaCG+++ k
  e_gw1.7.793.1 300 CLHCGTVKTPQWRMGPEGKKTLCNACGVRFMK 331
                    99***************************977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.5E-6294334IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.873294327IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.18E-12295331No hitNo description
Gene3DG3DSA:3.30.50.109.8E-14299331IPR013088Zinc finger, NHR/GATA-type
PfamPF003209.9E-15300331IPR000679Zinc finger, GATA-type
CDDcd002022.08E-12300329No hitNo description
PROSITE patternPS003440300325IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVTGERGTTT TTEDVGGASA AREAEDEPTP PATDEAWDVI NSFPIVRGDM VMCAGDGEQS  60
YGVNAPFIPP EFIERPIAAE AEGSDNEAEE DEEEDARRFS QAIRESSLLC EDDDVFDDDI  120
GAHADFISEP VAFAARREAR ELAAAAQVPG IDFMVKSGAL LCDDDYDAKD GNLECSAMTN  180
VSDYASEEEH FATAADGRVF RVSQALVAPS ASKLAKGHGK HRLEDSANRG GNDSEDSDAD  240
LVVQSARKAV PGKKTLATKR KRRPDAPIRR VKAAKKEKGS SVRATDIYVM SNGKRQRRGC  300
LHCGTVKTPQ WRMGPEGKKT LCNACGVRFM KGIL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAPTransfer from AT5G25830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001418973.16e-85predicted protein
TrEMBLA4S0H61e-83A4S0H6_OSTLU; Uncharacterized protein
STRINGABO972662e-84(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2201430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-15GATA transcription factor 12