PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID e_gw1.3.601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family GATA
Protein Properties Length: 237aa    MW: 24491.2 Da    PI: 7.6998
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
e_gw1.3.601.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.13.8e-16154188135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C +Cg+ ++p+WRrgp  +++LCnaCG +yr++++
  e_gw1.3.601.1 154 CDHCGAVDSPQWRRGPASKPMLCNACGTRYRRTNS 188
                    9***************99999**********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.532148203IPR000679Zinc finger, GATA-type
SMARTSM004011.8E-8148202IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.43E-11149192No hitNo description
Gene3DG3DSA:3.30.50.108.1E-12149197IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.28E-12153205No hitNo description
PfamPF003201.4E-13154187IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MDAEDDAVRE TTKAAAAAAA RAPERRWYRM VKMHDHGVCT TAVADAELAM LEASILRSAV  60
PSGCEVMVDG GGAGAGWNAD APCSSGEEGA RGRWAPDDVE YEECAVSGGF VGGAQDDSAS  120
AWERGGVASV AHATTHATTN AVASNGHMKP GGPCDHCGAV DSPQWRRGPA SKPMLCNACG  180
TRYRRTNSLG PAPSSRMATP DKRKNVAQND ARGKKNARCA VGGDNGKFSR ARAVVF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001416579.17e-75predicted protein
TrEMBLA4RTZ22e-73A4RTZ2_OSTLU; Uncharacterized protein
STRINGABO948723e-74(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4501526
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-11GATA transcription factor 26