PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OPUNC12G06260.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 273aa MW: 29720.7 Da PI: 10.7354 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 60.7 | 3.2e-19 | 16 | 61 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v+++G ++W++I++ ++ gR++k+c++rw + OPUNC12G06260.1 16 KGPWSPEEDEALQRLVARHGARNWSLISKSIP-GRSGKSCRLRWCNQ 61 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 51.3 | 2.8e-16 | 70 | 112 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++T++Ed+ +++a++++G++ W+tIar + gRt++ +k++w++ OPUNC12G06260.1 70 PFTPDEDDTILRAHARFGNK-WATIARLLA-GRTDNAIKNHWNST 112 89******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.091 | 11 | 66 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.11E-32 | 13 | 109 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.4E-17 | 15 | 64 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 7.2E-19 | 16 | 61 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.1E-26 | 17 | 69 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.10E-16 | 18 | 60 | No hit | No description |
SMART | SM00717 | 3.8E-14 | 67 | 115 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.907 | 68 | 117 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.3E-23 | 70 | 116 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.24E-11 | 70 | 113 | No hit | No description |
Pfam | PF00249 | 6.1E-14 | 70 | 112 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 273 aa Download sequence Send to blast |
MASCRRGGGG EVDRIKGPWS PEEDEALQRL VARHGARNWS LISKSIPGRS GKSCRLRWCN 60 QLSPQVEHRP FTPDEDDTIL RAHARFGNKW ATIARLLAGR TDNAIKNHWN STLKRKYLSQ 120 STDDRPLKRT SSDAAGAPAS PSASDLSDSS HHSLPSSPPH HLLPQHVYRP VARAGGVVVP 180 PPPATSLSLS LSLPGLGPST PSSQMPPFQL QPPPPPPPRP SAPFSAEFLA MMQEMIRIEV 240 RNYMSGSAAV DHRSPPDNGV RVTSRIMGMA KIE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-38 | 13 | 116 | 4 | 107 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. | |||||
UniProt | Transcription factor that functions in salt stress response. Acts as negative regulator of NHX7/SOS1 and CBL4/SOS3 induction in response to salt stress (PubMed:23809151). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB73 is enhanced by direct interaction between MYB73 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:23809151, ECO:0000269|PubMed:24894996}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00274 | DAP | Transfer from AT2G23290 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. | |||||
UniProt | INDUCTION: Induced by salt stress. {ECO:0000269|PubMed:23809151}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK066141 | 1e-167 | AK066141.1 Oryza sativa Japonica Group cDNA clone:J013055K23, full insert sequence. | |||
GenBank | AP005821 | 1e-167 | AP005821.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OSJNBa0094B20. | |||
GenBank | AP014965 | 1e-167 | AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012617 | 1e-167 | CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015612590.1 | 1e-124 | transcription factor MYB44 | ||||
Swissprot | O23160 | 2e-75 | MYB73_ARATH; Transcription factor MYB73 | ||||
Swissprot | Q9FDW1 | 2e-75 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A0E0MKV1 | 0.0 | A0A0E0MKV1_ORYPU; Uncharacterized protein | ||||
STRING | OPUNC12G06260.1 | 0.0 | (Oryza punctata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP789 | 38 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G23290.1 | 8e-65 | myb domain protein 70 |