PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OPUNC08G19670.6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 136aa MW: 14825 Da PI: 5.3604 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 43.8 | 3.3e-14 | 43 | 76 | 18 | 51 |
HHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 18 ngilKKAeELSvLCdaevaviifsstgklyeyss 51 g++KK +ELSvLCd+ev +++f + g lye++s OPUNC08G19670.6 43 RGMFKKVYELSVLCDTEVGLVVFFPAGSLYEFAS 76 59******************************86 PP | |||||||
2 | K-box | 16.5 | 3.6e-07 | 85 | 114 | 42 | 71 |
K-box 42 dLesLslkeLqqLeqqLekslkkiRskKne 71 ++++L++ eL+ Le+++ ++l+ +++k + OPUNC08G19670.6 85 NVNELNIAELRGLEEAMTNALTVVKNKLMM 114 5799********************988654 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 17.185 | 27 | 78 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 7.4E-17 | 27 | 77 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.44E-15 | 29 | 82 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-11 | 40 | 55 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.1E-11 | 43 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-11 | 55 | 76 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0071486 | Biological Process | cellular response to high light intensity | ||||
GO:0071492 | Biological Process | cellular response to UV-A | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MEEEVRTPPA AATVAAEGGG GGGKKNRKRG KVELRRIEDR TSRGMFKKVY ELSVLCDTEV 60 GLVVFFPAGS LYEFASSTSS VLESNVNELN IAELRGLEEA MTNALTVVKN KLMMKVAGVL 120 PQSEKKSCWI SEPDQE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242980 | 6e-67 | AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence. | |||
GenBank | DQ512367 | 6e-67 | DQ512367.1 Triticum aestivum MADS-box transcription factor TaAGL12 (AGL12) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649438.1 | 2e-44 | MADS-box transcription factor 51-like isoform X2 | ||||
Swissprot | Q9XJ61 | 9e-17 | MAD51_ORYSJ; MADS-box transcription factor 51 | ||||
TrEMBL | A0A0E0LXA0 | 2e-93 | A0A0E0LXA0_ORYPU; Uncharacterized protein | ||||
STRING | ONIVA08G24570.1 | 5e-45 | (Oryza nivara) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G11880.1 | 2e-14 | AGAMOUS-like 14 |
Publications ? help Back to Top | |||
---|---|---|---|
|