PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | OPUNC08G19670.5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 188aa MW: 21557.8 Da PI: 8.6263 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 83.5 | 1.3e-26 | 25 | 74 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ + rqv fskRr g++KKA+ELSvLCdae+a+++fs+ g+lye++s OPUNC08G19670.5 25 RIEDRTSRQVRFSKRRSGMFKKAYELSVLCDAEIALVVFSPAGRLYEFAS 74 8***********************************************86 PP | |||||||
2 | K-box | 17.5 | 1.7e-07 | 111 | 165 | 16 | 70 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 q+e++ L + + ++ + +l ++++L++ eL+ Le+++ ++l+ +++k + OPUNC08G19670.5 111 LRQKEHSVLDDPVPKINHITQCVLESNVNELNIAELRGLEEAMTNALTVVKNKLM 165 5567777777777777766677777889**********************98865 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.095 | 16 | 76 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.4E-35 | 16 | 75 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 18 | 38 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.72E-29 | 18 | 94 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.00E-35 | 18 | 86 | No hit | No description |
Pfam | PF00319 | 6.4E-26 | 25 | 72 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 38 | 53 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-28 | 53 | 74 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001708 | Biological Process | cell fate specification | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0010093 | Biological Process | specification of floral organ identity | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048833 | Biological Process | specification of floral organ number | ||||
GO:0071486 | Biological Process | cellular response to high light intensity | ||||
GO:0071492 | Biological Process | cellular response to UV-A | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MERRLPAADE AGGRRTKRGK VELRRIEDRT SRQVRFSKRR SGMFKKAYEL SVLCDAEIAL 60 VVFSPAGRLY EFASSTSSID KIFGRYWDLM HTTIDLNIEA RDYRVDCNIQ LRQKEHSVLD 120 DPVPKINHIT QCVLESNVNE LNIAELRGLE EAMTNALTVV KNKLMMKVAG VLPQSEKKSC 180 WISEPDQE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_R | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
1tqe_S | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_A | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_B | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_C | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_D | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_E | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
6c9l_F | 2e-18 | 18 | 88 | 3 | 71 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 13 | 20 | RRTKRGKV |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00605 | ChIP-seq | Transfer from AT1G24260 | Download |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK242980 | 0.0 | AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015649438.1 | 1e-105 | MADS-box transcription factor 51-like isoform X2 | ||||
TrEMBL | A0A0E0LX99 | 1e-137 | A0A0E0LX99_ORYPU; Uncharacterized protein | ||||
STRING | ORGLA08G0229900.1 | 1e-106 | (Oryza glaberrima) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03710.3 | 1e-32 | MIKC_MADS family protein |