PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OPUNC08G18260.1

Organism

Oryza punctata

Taxonomic ID

4537

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

M-type_MADS

Protein Properties

Length: 90aa MW: 10033.7 Da PI: 11.0338

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OPUNC08G18260.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	87.6	6.9e-28	25	74	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rie+ + rqv fskRr g++KKA+ELSvLCdaeva+++fs+ g+lye++s OPUNC08G18260.1 25 RIEDRTSRQVRFSKRRSGMFKKAHELSVLCDAEVALVVFSPAGRLYEFAS 74 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	3.3E-35	16	75	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.165	16	76	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	18	38	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-27	18	76	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.6E-27	25	72	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	38	53	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.3E-29	53	74	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MEAAAAEEGG GGGRKRKRGK VELRRIEDRT SRQVRFSKRR SGMFKKAHEL SVLCDAEVAL 60 VVFSPAGRLY EFASSASRMY LLLLCIRAVT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
1tqe_R	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
1tqe_S	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_A	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_B	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_C	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_D	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_E	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
6c9l_F	2e-18	18	75	3	60	Myocyte-specific enhancer factor 2B
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	12	18	GRKRKRG

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269\|PubMed:27776173}.
UniProt	Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269\|PubMed:17951465}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK242980	3e-83	AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence.
GenBank	AP005529	3e-83	AP005529.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0702E04.
GenBank	AP014964	3e-83	AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBank	AY177701	3e-83	AY177701.1 Oryza sativa (japonica cultivar-group) transcription factor MADS37 mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006660325.1	5e-35	PREDICTED: truncated transcription factor CAULIFLOWER D-like
Refseq	XP_020169632.1	6e-35	MADS-box transcription factor 51-like
Swissprot	A2Z9Q7	5e-26	MAD56_ORYSI; MADS-box transcription factor 56
Swissprot	P0C5B2	5e-26	MAD56_ORYSJ; MADS-box transcription factor 56
Swissprot	P29385	7e-26	AGL5_ARATH; Agamous-like MADS-box protein AGL5
Swissprot	Q9XJ61	3e-26	MAD51_ORYSJ; MADS-box transcription factor 51
TrEMBL	A0A0E0LWS4	2e-56	A0A0E0LWS4_ORYPU; Uncharacterized protein
STRING	OPUNC08G18260.1	4e-57	(Oryza punctata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11880.1	2e-25	AGAMOUS-like 14

Publications ? help Back to Top
Rice Chromosome 10 Sequencing Consortium In-depth view of structure, activity, and evolution of rice chromosome 10. Science, 2003. 300(5625): p. 1566-9 [PMID:12791992] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Kim SL,Lee S,Kim HJ,Nam HG,An G OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Bai Z, et al. The impact and origin of copy number variations in the Oryza species. BMC Genomics, 2016. 17: p. 261 [PMID:27025496] Rathnakumar K, et al. Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] Han Z,Zhang B,Zhao H,Ayaad M,Xing Y Genome-Wide Association Studies Reveal that Diverse Heading Date Genes Respond to Short and Long Day Lengths between Indica and Japonica Rice. Front Plant Sci, 2016. 7: p. 1270 [PMID:27621738] Ehlers K, et al. The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]