PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G19260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HRT-like
Protein Properties Length: 621aa    MW: 68652.6 Da    PI: 9.859
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G19260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like58.21.4e-18310339130
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      +CGv+ledGs C ++Pv+gRKRCe HKG+R
  OPUNC07G19260.1 310 VCGVMLEDGSSCLDSPVQGRKRCELHKGRR 339
                      7****************************9 PP

2HRT-like50.92.7e-16583612130
         HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmR 30 
                      iCG++  dGs+Ck+qP+ gRKRC+ HKG+R
  OPUNC07G19260.1 583 ICGARALDGSPCKNQPIAGRKRCAMHKGQR 612
                      8****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004652.7E-473182IPR000305GIY-YIG nuclease superfamily
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 621 aa     Download sequence    Send to blast
MPAASAAIPA RLKREDYPRT KHDSLFSPWK VLVGPSDWED HVAGKEGVQR YRVLNLPENF  60
PGLYELGVAR ASDEGIRARR WNGSGGGVVV VYLGQADSVR ARLQQYGRSG SHLDAGNPPP  120
SAGKAEMYPP ATTGNGLFRE VFARGYSLVF RCALMGNKQE AEKTEARLLR VFDYGWNKLQ  180
NGACRREEIL IKLEQGAVNN RSSLLSRVRH FKQEVFREKA GIKISRNGSV DVSSGIMKHM  240
LPRIRRFVGF RPQLVNYGDN VNKEIGIRWK NTSEGNSYGK QARRSSEGYI VKRVNVIKRR  300
TMSEQDSNNV CGVMLEDGSS CLDSPVQGRK RCELHKGRRL GRIRVNPKGS FYSYSCQVEI  360
PVVESIPPLT ENESKSDQAQ QTSELSKLLP ATVKESSRPR YSFEAKEMKT GEAPIEDGTH  420
ETSGVVDICE AKKSDNSACT NKIISGSKKC QLHNGCKAEE FVSPRVIDLL QNEEKVHSVT  480
GDKLSGEEIC HGKNQSQENQ PSGRMWFELL NLQNSTSTLS SKGQGRQRRV TSDVAAICGA  540
LTNNGCRETI PMAGRERCDA HEGIKVTDAY SVPFSGSSGW PSICGARALD GSPCKNQPIA  600
GRKRCAMHKG QRACRTPQST K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1027920.0AK102792.1 Oryza sativa Japonica Group cDNA clone:J033107P15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644815.10.0protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLA0A0E0LMT30.0A0A0E0LMT3_ORYPU; Uncharacterized protein
STRINGOPUNC07G19260.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79483443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.11e-69effector of transcription2