PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G09390.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 253aa    MW: 26363.1 Da    PI: 10.3118
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G09390.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-172569348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd+ll ++v++ Gg++W  Ia  ++ gRt+k+c++rw+++l
  OPUNC03G09390.1 25 GWSKEEDKLLRELVRKQGGKDWGVIATAFP-GRTDKSCRLRWRQHL 69
                     5*****************************.************996 PP

2Myb_DNA-binding46.67.7e-1577121248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +++++ Ed ++v++ + +G++ W+tIa+ ++ gR+++ +k+rw+++l
  OPUNC03G09390.1  77 LPFSAGEDRKIVELQRVHGNR-WATIAAFLP-GRSDNAVKNRWNTHL 121
                      589999***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3351873IPR017930Myb domain
SMARTSM007176.7E-172271IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-192272IPR009057Homeodomain-like
SuperFamilySSF466896.11E-2922117IPR009057Homeodomain-like
PfamPF002491.9E-162569IPR001005SANT/Myb domain
CDDcd001679.27E-172669No hitNo description
SMARTSM007172.3E-1275123IPR001005SANT/Myb domain
CDDcd001673.79E-1278121No hitNo description
Gene3DG3DSA:1.10.10.604.4E-1978122IPR009057Homeodomain-like
PfamPF002491.1E-1278121IPR001005SANT/Myb domain
PROSITE profilePS5129418.24378125IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MALEGATGGG GGGGLPGQEA GKKVGWSKEE DKLLRELVRK QGGKDWGVIA TAFPGRTDKS  60
CRLRWRQHLD PSVDVALPFS AGEDRKIVEL QRVHGNRWAT IAAFLPGRSD NAVKNRWNTH  120
LRKRHAQDGQ QRPPPGGLGL GGGCSGGGGA GQAAGGKLTP VCLPLFPLTP GFHHKQAPPI  180
GENLPGPARS AVPELLELFP LAPGDLRDNA SAAAAAAAAA MDVGTEAVRA LTELRLAPAA  240
VVFDAMPLQA IRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-282612410107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376960.0AC137696.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0049C20, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630256.11e-127transcription factor MYB1
TrEMBLA0A0E0KB081e-179A0A0E0KB08_ORYPU; Uncharacterized protein
STRINGOPUNC03G09390.11e-180(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.11e-32myb domain protein 109