PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OPUNC03G01630.6

Organism

Oryza punctata

Taxonomic ID

4537

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MIKC_MADS

Protein Properties

Length: 194aa MW: 21859.8 Da PI: 8.809

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OPUNC03G01630.6	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.3	2.7e-30	2	52	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s OPUNC03G01630.6 2 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 52 79***********************************************86 PP
2	K-box	50.1	1.2e-17	71	135	6	70
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 g+++ +++ e+ + +++ L k++e L+ +R+llGe+Le++s++eL++Le +Le+sl +iR +K OPUNC03G01630.6 71 GNKTVQQDIEQIKADAEGLAKKLEALEAYKRKLLGEKLEECSIEELHSLEVKLERSLISIRGRKC 135 45577888999****************************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.0E-32	1	53	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.931	1	54	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.77E-40	1	67	No hit	No description
SuperFamily	SSF55455	8.37E-31	1	77	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-27	3	50	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.9E-19	16	31	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	7.9E-19	31	52	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	5.9E-17	76	135	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	8.487	79	171	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MKRIENPTSR QVTFSKRRNG LLKKAFELSV LCDAEVALIV FSPRGKLYEF ASASTQKTIE 60 RYRTYTKENI GNKTVQQDIE QIKADAEGLA KKLEALEAYK RKLLGEKLEE CSIEELHSLE 120 VKLERSLISI RGRKCKNQPA MSAPSSVRAE DENPDRNINT TNDEMDVETE LFIGLPGRSR 180 SSGAAEDSRA KPHS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3kov_B	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3kov_I	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3kov_J	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3mu6_A	7e-18	3	65	9	71	Myocyte-specific enhancer factor 2A
3mu6_B	7e-18	3	65	9	71	Myocyte-specific enhancer factor 2A
3mu6_C	7e-18	3	65	9	71	Myocyte-specific enhancer factor 2A
3mu6_D	7e-18	3	65	9	71	Myocyte-specific enhancer factor 2A
3p57_A	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3p57_B	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3p57_C	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3p57_D	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3p57_I	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
3p57_J	1e-17	1	65	7	71	Myocyte-specific enhancer factor 2A
5f28_A	1e-17	3	65	10	72	MEF2C
5f28_B	1e-17	3	65	10	72	MEF2C
5f28_C	1e-17	3	65	10	72	MEF2C
5f28_D	1e-17	3	65	10	72	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway. {ECO:0000269\|PubMed:15144377, ECO:0000269\|PubMed:17166135}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB003328	0.0	AB003328.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:S11905.
GenBank	AK067641	0.0	AK067641.1 Oryza sativa Japonica Group cDNA clone:J013108C22, full insert sequence.
GenBank	AK104921	0.0	AK104921.1 Oryza sativa Japonica Group cDNA clone:001-047-H02, full insert sequence.
GenBank	AY332476	0.0	AY332476.1 Oryza sativa (japonica cultivar-group) MADS box protein (AGL20) mRNA, complete cds.
GenBank	CT830037	0.0	CT830037.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA030D10, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015630979.1	1e-126	MADS-box transcription factor 50
Refseq	XP_025880188.1	1e-126	MADS-box transcription factor 50
Swissprot	Q9XJ60	1e-127	MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBL	A0A0E0K838	1e-139	A0A0E0K838_ORYPU; Uncharacterized protein
STRING	OMERI03G01700.1	1e-124	(Oryza meridionalis)
STRING	OS03T0122600-01	1e-125	(Oryza sativa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62165.4	2e-58	AGAMOUS-like 42

Publications ? help Back to Top
Thomson MJ,Edwards JD,Septiningsih EM,Harrington SE,McCouch SR Substitution mapping of dth1.1, a flowering-time quantitative trait locus (QTL) associated with transgressive variation in rice, reveals multiple sub-QTL. Genetics, 2006. 172(4): p. 2501-14 [PMID:16452146] Park SJ, et al. Rice Indeterminate 1 (OsId1) is necessary for the expression of Ehd1 (Early heading date 1) regardless of photoperiod. Plant J., 2008. 56(6): p. 1018-29 [PMID:18774969] Lee S,Jeong DH,An G A possible working mechanism for rice SVP-group MADS-box proteins as negative regulators of brassinosteroid responses. Plant Signal Behav, 2008. 3(7): p. 471-4 [PMID:19704489] Maas LF,McClung A,McCouch S Dissection of a QTL reveals an adaptive, interacting gene complex associated with transgressive variation for flowering time in rice. Theor. Appl. Genet., 2010. 120(5): p. 895-908 [PMID:19949767] Sun C, et al. The histone methyltransferase SDG724 mediates H3K36me2/3 deposition at MADS50 and RFT1 and promotes flowering in rice. Plant Cell, 2012. 24(8): p. 3235-47 [PMID:22892321] Choi SC, et al. Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3. Plant Physiol., 2014. 164(3): p. 1326-37 [PMID:24420930] Núñez-López L,Aguirre-Cruz A,Barrera-Figueroa BE,Peña-Castro JM Improvement of enzymatic saccharification yield in Arabidopsis thaliana by ectopic expression of the rice SUB1A-1 transcription factor. PeerJ, 2015. 3: p. e817 [PMID:25780769] Jin J, et al. MORF-RELATED GENE702, a Reader Protein of Trimethylated Histone H3 Lysine 4 and Histone H3 Lysine 36, Is Involved in Brassinosteroid-Regulated Growth and Flowering Time Control in Rice. Plant Physiol., 2015. 168(4): p. 1275-85 [PMID:25855537] Liu X, et al. Brassinosteroid (BR) biosynthetic gene lhdd10 controls late heading and plant height in rice (Oryza sativa L.). Plant Cell Rep., 2016. 35(2): p. 357-68 [PMID:26518431] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Shibaya T, et al. Hd18, Encoding Histone Acetylase Related to Arabidopsis FLOWERING LOCUS D, is Involved in the Control of Flowering Time in Rice. Plant Cell Physiol., 2016. 57(9): p. 1828-38 [PMID:27318280] Alter P, et al. Flowering Time-Regulated Genes in Maize Include the Transcription Factor ZmMADS1. Plant Physiol., 2016. 172(1): p. 389-404 [PMID:27457125]