PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G26430.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 379aa    MW: 40473.2 Da    PI: 4.88
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G26430.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-164289148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  OPUNC02G26430.1 42 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 89
                     89******************************99************97 PP

2Myb_DNA-binding51.22.8e-1695140148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+e +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  OPUNC02G26430.1  95 RGNFTADEEETIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 140
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.363789IPR017930Myb domain
SuperFamilySSF466891.35E-2939136IPR009057Homeodomain-like
SMARTSM007171.1E-124191IPR001005SANT/Myb domain
PfamPF002494.0E-154289IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-234396IPR009057Homeodomain-like
CDDcd001672.22E-104489No hitNo description
PROSITE profilePS5129424.07190144IPR017930Myb domain
SMARTSM007172.5E-1494142IPR001005SANT/Myb domain
PfamPF002492.1E-1495140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2597144IPR009057Homeodomain-like
CDDcd001676.71E-1197140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MPSRSPSSAS SIIHCYPDRK RSDGGGMGRG RAPCCAKVGL NRGSWTPQED MRLIAYIQKH  60
GHANWRALPK QAGLLRCGKS CRLRWINYLR PDLKRGNFTA DEEETIIKLH GLLGNKWSKI  120
ASCLPGRTDN EIKNVWNTHL KKRVSQREKP GDTKNKGKAA DASDDADAHS PSSSASSSTT  180
TANNNNGSSS SGDTACTSKE PETVEVSLIE QDIDISDMLM DAPTEELLAG LAAPMPTSPC  240
SSSSLATTTC VGAVSDELLD LPEIDLEPEI WSIIDGYGGA AVVSGDATVP CTASPGEEGT  300
EWWVENLEKE LGLWGPMDES LAHPDPLGQV SYPGPLTETE GDPVSTYFRS GPTASPLREI  360
ASPAVLSGVP VRFGVEGRV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26401442105C-Myb DNA-Binding Domain
1msf_C1e-26401442105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117200.0AK111720.1 Oryza sativa Japonica Group cDNA clone:J023030I19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623616.10.0myb-related protein Zm1
SwissprotP200241e-130MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0E0K3W50.0A0A0E0K3W5_ORYPU; Uncharacterized protein
STRINGOPUNC02G26430.10.0(Oryza punctata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.19e-69myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]