PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

ONIVA12G01220.1

Organism

Oryza nivara

Taxonomic ID

4536

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

ZF-HD

Protein Properties

Length: 106aa MW: 10947 Da PI: 8.2955

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
ONIVA12G01220.1	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	104.7	5.7e-33	32	88	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + vrY+eC++NhAas+GghavDGC+Efm+s g++gtaaal CaACgCHR+FHRreve ONIVA12G01220.1 32 KVVRYRECQRNHAASIGGHAVDGCREFMAS-GADGTAAALLCAACGCHRSFHRREVEA 88 579************************9.999*******************986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	9.0E-13	32	100	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	4.1E-31	34	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.6E-27	35	86	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.592	36	85	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MGPQQDRSAA KPYANGSTAA AAAAAGRKEN NKVVRYRECQ RNHAASIGGH AVDGCREFMA 60 SGADGTAAAL LCAACGCHRS FHRREVEATA AECDCSSDTS SGTGRR

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CT833733	1e-180	CT833733.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA035B08, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015615851.1	9e-56	mini zinc finger protein 1
Refseq	XP_015620648.1	8e-56	mini zinc finger protein 2
Swissprot	B8BIU8	8e-57	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	B8BLT3	7e-57	MIF2_ORYSI; Mini zinc finger protein 2
Swissprot	B9GBM3	7e-57	MIF2_ORYSJ; Mini zinc finger protein 2
Swissprot	Q2RB28	8e-57	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	A0A0E0J672	2e-69	A0A0E0J672_ORYNI; Uncharacterized protein
STRING	ONIVA12G01220.1	4e-70	(Oryza nivara)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	1e-19	mini zinc finger 2

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]