PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA09G20130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 219aa    MW: 25396.6 Da    PI: 7.3004
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA09G20130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.2e-5461331128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhPtdeelv++yLk+kv+g +++l ++i+evd+yk+ePw+L+ k  + ++++ewyfF +rd+ky++g r+nrat++gyWk+tgkd+++
  ONIVA09G20130.1   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIDL-DIIPEVDLYKCEPWELEeKsFLPSKDSEWYFFGPRDRKYPNGCRTNRATRAGYWKSTGKDRRI 98 
                      79****************************.99**************84345566899************************************ PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++ +g+kktLv+ykgrap+g +t+Wvmheyr+
  ONIVA09G20130.1  99 NY-QNRSIGMKKTLVYYKGRAPQGIRTSWVMHEYRI 133
                      *9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-614159IPR003441NAC domain
PROSITE profilePS5100559.1716158IPR003441NAC domain
PfamPF023658.9E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKVHG LSIDLDIIPE VDLYKCEPWE LEEKSFLPSK  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRINY QNRSIGMKKT LVYYKGRAPQ  120
GIRTSWVMHE YRIEESECEN AMGIQLQDSY ALCRIFKKNV VLGEFDKKGE CSSSQAKGNE  180
EQVTDFGDAG QSSGANENDK DNSWMQFIAE DLWCTNKLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-54115912166NO APICAL MERISTEM PROTEIN
1ut4_B3e-54115912166NO APICAL MERISTEM PROTEIN
1ut7_A3e-54115912166NO APICAL MERISTEM PROTEIN
1ut7_B3e-54115912166NO APICAL MERISTEM PROTEIN
3swm_A3e-54115915169NAC domain-containing protein 19
3swm_B3e-54115915169NAC domain-containing protein 19
3swm_C3e-54115915169NAC domain-containing protein 19
3swm_D3e-54115915169NAC domain-containing protein 19
3swp_A3e-54115915169NAC domain-containing protein 19
3swp_B3e-54115915169NAC domain-containing protein 19
3swp_C3e-54115915169NAC domain-containing protein 19
3swp_D3e-54115915169NAC domain-containing protein 19
4dul_A3e-54115912166NAC domain-containing protein 19
4dul_B3e-54115912166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1375961e-155AC137596.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 9 clone OSJNBb0031H05, complete sequence.
GenBankAP0055641e-155AP005564.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1228_C03, complete sequence.
GenBankAP0149651e-155AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126171e-155CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612703.11e-163NAC domain-containing protein 86 isoform X1
SwissprotQ9FFI51e-87NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0E0B6921e-164A0A0E0B692_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0EUN41e-164A0A0E0EUN4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0INE01e-164A0A0E0INE0_ORYNI; Uncharacterized protein
TrEMBLA2Z3V61e-164A2Z3V6_ORYSI; Uncharacterized protein
TrEMBLI1QR391e-164I1QR39_ORYGL; Uncharacterized protein
STRINGOGLUM09G19480.11e-165(Oryza glumipatula)
STRINGOMERI09G14330.11e-165(Oryza meridionalis)
STRINGONIVA09G20130.11e-165(Oryza nivara)
STRINGORGLA09G0151800.11e-165(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-108NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]