PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA02G31530.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 344aa    MW: 36827 Da    PI: 4.5009
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA02G31530.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT++Ed +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  ONIVA02G31530.1 16 RGSWTPQEDMRLIAYIQKHGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

2Myb_DNA-binding49.78.4e-1669114148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  ONIVA02G31530.1  69 RGNFTADEEDTIIKLHGLLGNK-WSKIASCLP-GRTDNEIKNVWNTHL 114
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23766IPR009057Homeodomain-like
PROSITE profilePS5129414.361163IPR017930Myb domain
SuperFamilySSF466891.03E-2913110IPR009057Homeodomain-like
SMARTSM007171.1E-121565IPR001005SANT/Myb domain
PfamPF002493.5E-151663IPR001005SANT/Myb domain
CDDcd001672.24E-101863No hitNo description
PROSITE profilePS5129423.664118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2567118IPR009057Homeodomain-like
SMARTSM007175.9E-1468116IPR001005SANT/Myb domain
PfamPF002493.5E-1469114IPR001005SANT/Myb domain
CDDcd001671.91E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGRGRAPCCA KVGLNRGSWT PQEDMRLIAY IQKHGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTADEEDTI IKLHGLLGNK WSKIASCLPG RTDNEIKNVW NTHLKKRVSQ  120
RKKPGDTKKK GKAADASDDA DAHSPSSSAS SSTTTVANNN NSGDTAGEQC GTSKEPENVD  180
VSFFEQDIDI SDMLVDAPTE APLVAAPMPP SPCSSSSLTT TTCVGAVSDE LLDLPEIDIE  240
PDIWSIIDGY GGDEPVVSGA DGDATVPCTA SPGEEGAEWW VENLEKELGL WGPMDESLAH  300
PDPPGQVCYP GPLTETEGDP VSTYFQSGPT ASPLQEIASP AVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-26141182105C-Myb DNA-Binding Domain
1msf_C1e-26141182105C-Myb DNA-Binding Domain
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that regulates positively genes involved in anthocyanin biosynthesis such as A1. {ECO:0000269|PubMed:7920701}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117200.0AK111720.1 Oryza sativa Japonica Group cDNA clone:J023030I19, full insert sequence.
GenBankAK1119330.0AK111933.1 Oryza sativa Japonica Group cDNA clone:001-017-B10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623616.10.0myb-related protein Zm1
SwissprotP200241e-133MYB1_MAIZE; Myb-related protein Zm1
TrEMBLA0A0E0GBL20.0A0A0E0GBL2_ORYNI; Uncharacterized protein
STRINGONIVA02G31530.10.0(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.11e-68myb domain protein 63
Publications ? help Back to Top
  1. Franken P,Schrell S,Peterson PA,Saedler H,Wienand U
    Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38.
    Plant J., 1994. 6(1): p. 21-30
    [PMID:7920701]