PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA01G42920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 173aa    MW: 19317.5 Da    PI: 9.0793
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA01G42920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.8e-081563147
                     TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     r +W++ Ed+ +  a  + + +   +W+++a+ ++ gRt+ +  +++q +
  ONIVA01G42920.1 15 RRPWSKVEDKVFESALVLCPEDvpdRWALVAAQLP-GRTPQEALEHYQVL 63
                     679********************************.******99999976 PP

2Myb_DNA-binding41.33.6e-13106150347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W+++E+ l++++  ++G g+W+ I+r    +Rt+ q+ s+ qky
  ONIVA01G42920.1 106 PWSEDEHRLFLEGLDRYGRGDWRNISRFSVRTRTPTQVASHAQKY 150
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512947.4671068IPR017930Myb domain
SuperFamilySSF466891.29E-101263IPR009057Homeodomain-like
SMARTSM007175.0E-61466IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-61562IPR009057Homeodomain-like
PfamPF002492.3E-61562IPR001005SANT/Myb domain
CDDcd001671.82E-51764No hitNo description
PROSITE profilePS5129418.86699155IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-10100156IPR009057Homeodomain-like
SuperFamilySSF466895.02E-17101155IPR009057Homeodomain-like
SMARTSM007173.3E-10103153IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.4E-16103154IPR006447Myb domain, plants
CDDcd001675.85E-10106151No hitNo description
PfamPF002498.9E-11106150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDLYGAAAGG GPVARRPWSK VEDKVFESAL VLCPEDVPDR WALVAAQLPG RTPQEALEHY  60
QVLVADIDLI MRGAVDAPGS WDNNDGNDRR GGGGKPRGEE RRRGVPWSED EHRLFLEGLD  120
RYGRGDWRNI SRFSVRTRTP TQVASHAQKY FIRQANAGAR DSKRKSIHDI TTP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1616105990RADIALIS
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM2628330.0KM262833.1 Oryza sativa Indica Group cultivar Nagina 22 MYB transcription factor (MYB) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622460.11e-124transcription factor DIVARICATA
SwissprotQ8S9H72e-48DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0E0FW281e-123A0A0E0FW28_ORYNI; Uncharacterized protein
TrEMBLA2WX901e-123A2WX90_ORYSI; MYB transcription factor
STRINGONIVA01G42920.11e-124(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.13e-44MYB family protein
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]