PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G18770.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1025aa    MW: 115612 Da    PI: 6.8754
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G18770.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox44.13.5e-142173557
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     t+ ++ q++ Le+++ + +yp+ e+++e A++++Lt +qV++WF+ rR ke++
  OMERI07G18770.3 21 TKKSPLQIQMLERFYSEIQYPQSEDIAEYATSVDLTYNQVRIWFKERRRKERR 73
                     567899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-141374IPR009057Homeodomain-like
PROSITE profilePS5007114.8031474IPR001356Homeobox domain
SuperFamilySSF466891.2E-121678IPR009057Homeodomain-like
SMARTSM003895.5E-131678IPR001356Homeobox domain
PfamPF000461.6E-112173IPR001356Homeobox domain
CDDcd000862.38E-82164No hitNo description
PfamPF156121.8E-5529560IPR028942WHIM1 domain
PfamPF156136.3E-11652723IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1025 aa     Download sequence    Send to blast
MAAVRKMAAN GLAAKRENTG TKKSPLQIQM LERFYSEIQY PQSEDIAEYA TSVDLTYNQV  60
RIWFKERRRK ERRETESLGA HMEKQLRDKH TLRSQVLFPK DYILRKVFRK DGPPLGSEFD  120
PLPHSAPGHL RDTTDDHFYQ NQRVIKKRKI VEPTTQRSSL PCGDSGPVRK HGAGKGLMTV  180
WHAMYSHSSK IQDGSNFIDE TGCLRSLRPL DDCGRTEDCD DGKLIQVPCS RVTAPKKHPP  240
MECHLSVDES QSPVLQANQV TLVDDEELEL RELQAGPNPL RCSAHLSSSG RHGCPLCKDL  300
LSRFPPSSVK MKQPFSTRPW GSSPEMVKKL FQVREQEFDM NFWIKSLNSL TWVEILRQVL  360
VASGFGSKHH MLNRDFFNKE KNQMVKYGLR PRTLKGELFA LLSKKGSGGL KVSELAKSPE  420
IVDLNISSTE IEQLIYSTLS SDITLFEKIA PSAYRLRVDP RIKGKEDFGS DTEDSGSVDD  480
HSDASSGADE SDDSHEMSFS EHEHRILRRK RKNGHENVNR CSEIDESYSG ERWLLGLMEG  540
EYSDLSIDEK LDCLVALMDV VSGADSAPRL EEPPRVVPSI PRAQPHVSGG KIKKSTRNIC  600
QSSDQCFNAS GSMHGLDSSM HEQSRSLRSR DYVAYSGRND TSTGVAHQPQ VVLLGSDRRY  660
NNYWLFLGPC RADDPGHRRV YFESSEDGHW EVIDSPQELL SLLASLDSRG TREAYLLASM  720
KKRQTCLFEA MKKHYENRDA VQPAMPSDTS HSETSSGDGA SPKLSSGDGA SPTSDIDNAS  780
VPTNPAENMI NASSAIAIEV GRRGDEKILK WERSQTFDKW IWTSFYSCLT AVKCGKKSFK  840
ESLVRCESCH DLYWRDEKHC RICHSTFEVS FDLEERYAIH VATCRDPEDA YDVPNHKVLP  900
SQLQALKAAI HAIEAHMPEA AFAGLWMKSS HKLWVKRLRR TSSLAELLQV LVDFVGAMDE  960
DWLYKSSSSV SFCSYLDDIV IYFQTMPQTT SAVALWVVKL DALITPYLER ADSDRALGEE  1020
NASMR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673RRRKERRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657968.10.0PREDICTED: homeobox-DDT domain protein RLT3
RefseqXP_015695304.10.0PREDICTED: homeobox-DDT domain protein RLT3
TrEMBLA0A0E0EEF90.0A0A0E0EEF9_9ORYZ; Uncharacterized protein
STRINGOMERI07G19150.10.0(Oryza meridionalis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.14e-42Homeodomain-like transcriptional regulator