PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI07G18770.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 1099aa    MW: 124146 Da    PI: 7.0142
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI07G18770.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox443.8e-142173557
                     SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
         Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                     t+ ++ q++ Le+++ + +yp+ e+++e A++++Lt +qV++WF+ rR ke++
  OMERI07G18770.2 21 TKKSPLQIQMLERFYSEIQYPQSEDIAEYATSVDLTYNQVRIWFKERRRKERR 73
                     567899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-141374IPR009057Homeodomain-like
PROSITE profilePS5007114.8031474IPR001356Homeobox domain
SuperFamilySSF466891.2E-121678IPR009057Homeodomain-like
SMARTSM003895.5E-131678IPR001356Homeobox domain
PfamPF000461.8E-112173IPR001356Homeobox domain
CDDcd000862.47E-82164No hitNo description
PfamPF156121.9E-5603634IPR028942WHIM1 domain
PfamPF156136.8E-11726797IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1099 aa     Download sequence    Send to blast
MAAVRKMAAN GLAAKRENTG TKKSPLQIQM LERFYSEIQY PQSEDIAEYA TSVDLTYNQV  60
RIWFKERRRK ERRETESLGA HMEKQLSARS NGFRCSSSSS RSSTFSRSTM YRNVSLRPED  120
DRYVDKGMSF TGDKHTLRSQ VLFPKDYILR KVFRKDGPPL GSEFDPLPHS APGHLRDTTD  180
DHFYQNQRVI KKRKIVEPTT QRSSLPCGDS GPVRKHGAGK GLMTVWHAMY SHSSKIQDGS  240
NFIDETGCLR SLRPLDDCGR TEDCDDGKLI QVPCSRVTAP KKHPPMECHL SVDESQSPVL  300
QANQVTLVDD EELELRELQA GPNPLRCSAH LSSSGRHGCP LCKDLLSRFP PSSVKMKQPF  360
STRPWGSSPE MVKKLFQVVR FIYNRFGYMD VHPFTFDELA QAFHDKVREQ EFDMNFWIKS  420
LNSLTWVEIL RQVLVASGFG SKHHMLNRDF FNKEKNQMVK YGLRPRTLKG ELFALLSKKG  480
SGGLKVSELA KSPEIVDLNI SSTEIEQLIY STLSSDITLF EKIAPSAYRL RVDPRIKGKE  540
DFGSDTEDSG SVDDHSDASS GADESDDSHE MSFSEHEHRI LRRKRKNGHE NVNRCSEIDE  600
SYSGERWLLG LMEGEYSDLS IDEKLDCLVA LMDVVSGADS APRLEEPPRV VPSIPRAQPH  660
VSGGKIKKST RNICQSSDQC FNASGSMHGL DSSMHEQSRS LRSRDYVAYS GRNDTSTGVA  720
HQPQVVLLGS DRRYNNYWLF LGPCRADDPG HRRVYFESSE DGHWEVIDSP QELLSLLASL  780
DSRGTREAYL LASMKKRQTC LFEAMKKHYE NRDAVQPAMP SDTSHSETSS GDGASPKLSS  840
GDGASPTSDI DNASVPTNPA ENMINASSAI AIEVGRRGDE KILKWERSQT FDKWIWTSFY  900
SCLTAVKCGK KSFKESLVRC ESCHDLYWRD EKHCRICHST FEVSFDLEER YAIHVATCRD  960
PEDAYDVPNH KVLPSQLQAL KAAIHAIEAH MPEAAFAGLW MKSSHKLWVK RLRRTSSLAE  1020
LLQVLVDFVG AMDEDWLYKS SSSVSFCSYL DDIVIYFQTM PQTTSAVALW VVKLDALITP  1080
YLERADSDRA LGEENASMR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16673RRRKERRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646956.10.0homeobox-DDT domain protein RLT3 isoform X1
TrEMBLA0A0E0EEF80.0A0A0E0EEF8_9ORYZ; Uncharacterized protein
STRINGOMERI07G19150.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45563350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.16e-84Homeodomain-like transcriptional regulator