PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI05G20240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TCP
Protein Properties Length: 302aa    MW: 31328.7 Da    PI: 8.0906
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI05G20240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP973.5e-3060136383
              TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                      g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WL+++a+++i++l+ ++++++    +++ + +a+
  OMERI05G20240.1  60 GGKDRHSKVRTVKGLRDRRVRLSVPTAIQLYDLQDRLGLSQPSKVVDWLINAAQAEIDKLPPLQFPPH----DHDLVAAAA 136
                      78*************************************************************99998....233333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136929.95961119IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-2661124IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MKSNNSTNEE LGCGGRKAAD QPSGGGGAAA AAKASAAVAS SRHWSASTES RIVRVSRVFG  60
GKDRHSKVRT VKGLRDRRVR LSVPTAIQLY DLQDRLGLSQ PSKVVDWLIN AAQAEIDKLP  120
PLQFPPHDHD LVAAAAAAAT SMAPPPFANG GDHHGVSASS MLEDGDKAAA HGGGMKAFMS  180
LSNSLGLLNA ATMPATLAAH HHHHHHAAYY AAAESWGNGG NGGHHHDVGH GVSPSAHNSP  240
FPSLLSLAPG SHHQFVFYSP EGGGFAMKEA AAEQFPVDSL DHSQGQLTLS SARSFLHSGS  300
QG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2066120155Putative transcription factor PCF6
5zkt_B1e-2066120155Putative transcription factor PCF6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1306040.0AC130604.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone B1155G07, complete sequence.
GenBankAK0699380.0AK069938.1 Oryza sativa Japonica Group cDNA clone:J023038I07, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankGQ2294840.0GQ229484.1 Oryza sativa Japonica Group TCP transcription factor (TCP11) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637968.11e-146transcription factor TCP13
TrEMBLA0A0E0DTT90.0A0A0E0DTT9_9ORYZ; Uncharacterized protein
STRINGOMERI05G19410.10.0(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24903584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.13e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5