PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

OMERI05G05900.2

Organism

Oryza meridionalis

Taxonomic ID

40149

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

MIKC_MADS

Protein Properties

Length: 272aa MW: 30832.7 Da PI: 8.7047

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
OMERI05G05900.2	genome	OGE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.4	2.8e-31	51	101	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+ OMERI05G05900.2 51 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101 79***********************************************95 PP
2	K-box	105.2	8e-35	119	215	5	100
K-box 5 sgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 s+ s ++e +a+++qqe+akLk++i nLq+++R l+G+++++++++eL+qLe +L+k+l kiR++Knell+++ie++q++e elq++n++L++k OMERI05G05900.2 119 SNASiVAEINAQHYQQEAAKLKQQITNLQNSNRTLVGDNITTMNHRELKQLEGRLDKGLGKIRARKNELLCAEIEYMQRRETELQNDNMYLKSK 212 333469999************************************************************************************* PP K-box 98 lee 100 ++e OMERI05G05900.2 213 VAE 215 986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.422	43	103	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-39	43	102	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	45	65	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.94E-33	45	115	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	45	99	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.81E-44	45	117	No hit	No description
Pfam	PF00319	1.2E-26	52	99	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	65	80	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.1E-32	80	101	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.2E-26	128	213	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	14.732	129	219	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 272 aa Download sequence Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGG SGGSGSVGAE KIGSRGKIEI KRIENTTNRQ 60 VTFCKRRNGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNSVKETIER YKKANSDTSN 120 ASIVAEINAQ HYQQEAAKLK QQITNLQNSN RTLVGDNITT MNHRELKQLE GRLDKGLGKI 180 RARKNELLCA EIEYMQRRET ELQNDNMYLK SKVAESERGL QTVNMMGSAS TSEYVQNMIH 240 YDPRNFLQFN IMQQPQYYPE QEDRKAFMSD ER

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3kov_B	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3kov_I	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3kov_J	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_A	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_B	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_C	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_D	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_I	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
3p57_J	8e-20	45	130	2	90	Myocyte-specific enhancer factor 2A
5f28_A	8e-20	45	130	3	91	MEF2C
5f28_B	8e-20	45	130	3	91	MEF2C
5f28_C	8e-20	45	130	3	91	MEF2C
5f28_D	8e-20	45	130	3	91	MEF2C
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB232157	0.0	AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBank	FJ750942	0.0	FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015638060.1	0.0	MADS-box transcription factor 58 isoform X1
Swissprot	Q2V0P1	0.0	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A0E0DN63	0.0	A0A0E0DN63_9ORYZ; Uncharacterized protein
STRING	OMERI05G05690.1	0.0	(Oryza meridionalis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	8e-95	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]