PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 9763 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 65aa MW: 7445.72 Da PI: 11.0233 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 28 | 4.7e-09 | 1 | 55 | 8 | 62 |
HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 rrk+ NRe+A+rs RKkae ++L +++L + +++k++ l+k+v++l +e 9763 1 RRKIANRESAKRSKIRKKAEDAKLLSAAETLLQDSASMRKTITDLQKKVDTLYAE 55 8************************************************999776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 1.0E-8 | 1 | 52 | No hit | No description |
SuperFamily | SSF57959 | 1.75E-6 | 1 | 53 | No hit | No description |
PROSITE profile | PS50217 | 9.347 | 1 | 59 | IPR004827 | Basic-leucine zipper domain |
SMART | SM00338 | 0.0019 | 1 | 58 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 7.9E-8 | 1 | 55 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 65 aa Download sequence Send to blast |
RRKIANRESA KRSKIRKKAE DAKLLSAAET LLQDSASMRK TITDLQKKVD TLYAENVKLR 60 MKLGE |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000584 | 1e-105 | CP000584.1 Ostreococcus lucimarinus CCE9901 chromosome 4, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001417196.1 | 1e-37 | predicted protein, partial | ||||
TrEMBL | A4RVS1 | 3e-36 | A4RVS1_OSTLU; Uncharacterized protein (Fragment) | ||||
STRING | ABO95489 | 5e-37 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP9223 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G32150.1 | 9e-12 | basic region/leucine zipper transcription factor 68 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 9763 |