PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 9704 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 66aa MW: 7872.05 Da PI: 9.8882 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 106.9 | 1.1e-33 | 11 | 66 | 2 | 57 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 ++ a++cprC+s++tkfCyynny+++qPr++Ck+C ryWt+GG+lrnv vG+grrk 9704 11 PDYAVACPRCKSDDTKFCYYNNYNIKQPRFYCKKCCRYWTEGGSLRNVRVGAGRRK 66 677899*************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-20 | 1 | 66 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.1E-28 | 14 | 66 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 25.574 | 15 | 66 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 17 | 53 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
DEKKREPLPK PDYAVACPRC KSDDTKFCYY NNYNIKQPRF YCKKCCRYWT EGGSLRNVRV 60 GAGRRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000584 | 1e-106 | CP000584.1 Ostreococcus lucimarinus CCE9901 chromosome 4, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001417524.1 | 5e-42 | predicted protein, partial | ||||
Swissprot | Q8LAP8 | 3e-26 | DOF46_ARATH; Dof zinc finger protein DOF4.6 | ||||
TrEMBL | A4RW53 | 1e-40 | A4RW53_OSTLU; Uncharacterized protein (Fragment) | ||||
STRING | ABO95817 | 2e-41 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP4655 | 11 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G24060.1 | 1e-28 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | 9704 |
Publications ? help Back to Top | |||
---|---|---|---|
|