PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | 35958 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 115aa MW: 13057 Da PI: 7.4159 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 175.3 | 6.2e-55 | 13 | 105 | 2 | 94 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 reqdrflP+an+ rimkk+lPanaki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfe+y+ pl+vyl+ yr++ 35958 13 REQDRFLPVANINRIMKKALPANAKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEEYIRPLRVYLQGYRNVS 105 89****************************************************************************************985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.9E-51 | 7 | 104 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.81E-38 | 15 | 103 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.5E-28 | 18 | 82 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.3E-19 | 46 | 64 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 49 | 65 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.3E-19 | 65 | 83 | No hit | No description |
PRINTS | PR00615 | 1.3E-19 | 84 | 102 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 115 aa Download sequence Send to blast |
MPTAHEADAS VAREQDRFLP VANINRIMKK ALPANAKIAK DAKETVQECV SEFISFITSE 60 ASDKCQREKR KTINGDDLLW AMSTLGFEEY IRPLRVYLQG YRNVSSIFFH ELVF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-45 | 13 | 102 | 3 | 92 | NF-YB |
4awl_B | 2e-45 | 13 | 102 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-45 | 13 | 102 | 4 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | CP000582 | 1e-95 | CP000582.1 Ostreococcus lucimarinus CCE9901 chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_001416214.1 | 2e-81 | predicted protein | ||||
Swissprot | O23310 | 8e-58 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | P25209 | 1e-57 | NFYB_MAIZE; Nuclear transcription factor Y subunit B | ||||
TrEMBL | A4RSN4 | 4e-80 | A4RSN4_OSTLU; Uncharacterized protein | ||||
STRING | ABO94507 | 7e-81 | (Ostreococcus 'lucimarinus') |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP2023 | 16 | 16 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 3e-60 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | 35958 |
Publications ? help Back to Top | |||
---|---|---|---|
|