PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 19031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; prasinophytes; Mamiellophyceae; Mamiellales; Bathycoccaceae; Ostreococcus
Family NF-YC
Protein Properties Length: 206aa    MW: 22410.9 Da    PI: 4.5489
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
19031genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC53.26.4e-17371171797
  NF-YC  17 knhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97 
            +++ lP+ar+k+i+k d+dvk+ sa+a   ++ka elf+  l++ s    + +kr+ ++  d+++ v r  +++fl d+v 
  19031  37 NDTVLPVARVKRIIKLDKDVKQASADAIKCVTKATELFLEGLAVGSHAGMRAAKRKGVQYKDLESFVLRRGKYEFLHDHVW 117
            4678**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.08E-1432119IPR009072Histone-fold
PfamPF008083.3E-1241101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.106.6E-1941116IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MKEDTEKAYE AAVAAAVARG EVPEEKTADV DGKPAENDTV LPVARVKRII KLDKDVKQAS  60
ADAIKCVTKA TELFLEGLAV GSHAGMRAAK RKGVQYKDLE SFVLRRGKYE FLHDHVWAMR  120
PREGEKGDDD DDDDDDDDDD DAPSAKKAKK LADANGSRRV TEFFKPGESP TKKPANDEDE  180
IVIDAAPTQT QTAAAVIPET EIQTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5y26_B6e-14391141388Putative transcription factor C16C4.22
5y27_B6e-14391141388Putative transcription factor C16C4.22
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0006000.0CP000600.1 Ostreococcus lucimarinus CCE9901 chromosome 20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001422703.11e-145predicted protein
TrEMBLA4SB261e-144A4SB26_OSTLU; Uncharacterized protein
STRINGABP010201e-145(Ostreococcus 'lucimarinus')
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP261633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.14e-11nuclear factor Y, subunit C10