PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN541991.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 53aa    MW: 6006.79 Da    PI: 6.4979
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN541991.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-121445132
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                       +g+WT+eEd+ lv +v+++G+g+W++++ + g
  KN541991.1_FGP001 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTG 45
                       79************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-14543IPR009057Homeodomain-like
SuperFamilySSF466892.66E-10944IPR009057Homeodomain-like
PROSITE profilePS5129414.844953IPR017930Myb domain
PfamPF002491.0E-101445IPR001005SANT/Myb domain
CDDcd001674.73E-81647No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 53 aa     Download sequence    Send to blast
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGDDHLY RLS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN541991.1_FGP001
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0042603e-85AP004260.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0011H09.
GenBankAP0043063e-85AP004306.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0506F02.
GenBankAP0149633e-85AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankCP0126153e-85CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004489392.11e-25myb-related protein 306-like
RefseqXP_015645343.12e-25transcription factor MYB30
SwissprotQ9SCU73e-25MYB30_ARATH; Transcription factor MYB30
TrEMBLB8B4W92e-25B8B4W9_ORYSI; Uncharacterized protein
TrEMBLQ7X8X32e-25Q7X8X3_ORYSJ; Os07g0629000 protein
STRINGOS07T0629000-013e-26(Oryza sativa)
STRINGLPERR07G20060.12e-25(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-27myb domain protein 30
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Kaurilind E,Xu E,Brosché M
    A genetic framework for H2O2 induced cell death in Arabidopsis thaliana.
    BMC Genomics, 2015. 16: p. 837
    [PMID:26493993]
  3. Lee HG,Seo PJ
    The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96.
    Nat Commun, 2016. 7: p. 12525
    [PMID:27615387]
  4. Serrano I, et al.
    A non canonical subtilase attenuates the transcriptional activation of defence responses in Arabidopsis thaliana.
    Elife, 2017.
    [PMID:27685353]
  5. Liao C,Zheng Y,Guo Y
    MYB30 transcription factor regulates oxidative and heat stress responses through ANNEXIN-mediated cytosolic calcium signaling in Arabidopsis.
    New Phytol., 2017. 216(1): p. 163-177
    [PMID:28726305]
  6. Lee HG,Kim J,Suh MC,Seo PJ
    The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.
    Plant Cell Physiol., 2017. 58(7): p. 1249-1259
    [PMID:28838126]
  7. Mabuchi K, et al.
    MYB30 links ROS signaling, root cell elongation, and plant immune responses.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(20): p. E4710-E4719
    [PMID:29712840]
  8. Zheng Y,Chen Z,Ma L,Liao C
    The Ubiquitin E3 Ligase RHA2b Promotes Degradation of MYB30 in Abscisic Acid Signaling.
    Plant Physiol., 2018. 178(1): p. 428-440
    [PMID:30030326]