PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN541991.1_FGP001 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 53aa MW: 6006.79 Da PI: 6.4979 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 38.8 | 2.1e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd+ lv +v+++G+g+W++++ + g KN541991.1_FGP001 14 KGPWTPEEDLVLVSYVQEHGPGNWRAVPTRTG 45 79************************998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.8E-14 | 5 | 43 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 2.66E-10 | 9 | 44 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.844 | 9 | 53 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.0E-10 | 14 | 45 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.73E-8 | 16 | 47 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 53 aa Download sequence Send to blast |
MVRPPCCDKD GVKKGPWTPE EDLVLVSYVQ EHGPGNWRAV PTRTGDDHLY RLS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to the DNA sequence 5'-AACAAAC-3' (PubMed:19170933). Acts as a positive regulator of hypersensitive cell death (PubMed:10571865, PubMed:12119395). Acts as a positive regulator of salicylic acid synthesis (PubMed:16730712). Regulates very-long-chain fatty acid biosynthesis (PubMed:18326828). Acts cooperatively with BZR2 to promote expression of a subset of brassinosteroids target genes (PubMed:19170933). Transcriptional activity and hypersensitive response control negatively regulated by PLA2-ALPHA and by the Xanthomonas type III effector XopD (AC G9L9K6) (PubMed:20696912, PubMed:21917550). Involved in the regulation of abscisic acid (ABA) signaling (PubMed:22814374). Increased levels of MYB30 can accelerate flowering both in long and short days through the regulation of FT (PubMed:24587042). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:12119395, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:18326828, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912, ECO:0000269|PubMed:21917550, ECO:0000269|PubMed:22814374, ECO:0000269|PubMed:24587042}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN541991.1_FGP001 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated during hypersensitive response, but no expression detected during compatible interaction with pathogens (PubMed:10571865). Specifically induced in the inoculated zone 4 hours post pathogen infection (PubMed:20696912). Up-regulated by jasmonic acid and salicylic acid (PubMed:16463103, PubMed:16730712). Transcriptionally regulated by BZR2 (PubMed:19170933). {ECO:0000269|PubMed:10571865, ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16730712, ECO:0000269|PubMed:19170933, ECO:0000269|PubMed:20696912}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP004260 | 3e-85 | AP004260.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0011H09. | |||
GenBank | AP004306 | 3e-85 | AP004306.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0506F02. | |||
GenBank | AP014963 | 3e-85 | AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence. | |||
GenBank | CP012615 | 3e-85 | CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004489392.1 | 1e-25 | myb-related protein 306-like | ||||
Refseq | XP_015645343.1 | 2e-25 | transcription factor MYB30 | ||||
Swissprot | Q9SCU7 | 3e-25 | MYB30_ARATH; Transcription factor MYB30 | ||||
TrEMBL | B8B4W9 | 2e-25 | B8B4W9_ORYSI; Uncharacterized protein | ||||
TrEMBL | Q7X8X3 | 2e-25 | Q7X8X3_ORYSJ; Os07g0629000 protein | ||||
STRING | OS07T0629000-01 | 3e-26 | (Oryza sativa) | ||||
STRING | LPERR07G20060.1 | 2e-25 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP229 | 38 | 296 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G28910.1 | 1e-27 | myb domain protein 30 |