PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | KN539717.1_FGP004 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 168aa MW: 19542.3 Da PI: 9.6578 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 87.8 | 9.3e-28 | 102 | 152 | 2 | 52 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEE CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitY 52 +Dgy+WrKYGqK vk+s++prsYYrCt+++Cpvkk+vers +dp vv++t+ KN539717.1_FGP004 102 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCPVKKRVERSYQDPAVVITTW 152 8**********************************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 2.4E-29 | 86 | 153 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.75E-24 | 93 | 154 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 26.199 | 96 | 152 | IPR003657 | WRKY domain |
SMART | SM00774 | 3.9E-27 | 101 | 160 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.7E-21 | 102 | 153 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 168 aa Download sequence Send to blast |
MSGEYQFQDE LAPLFARPGG GAGEMQMLPS SWFADYLQAG TPMQMDYDLM CRALELPVGE 60 DVKREVVWQR SAAKGGKAGK GEKRARQPRF AFMTKSEVDH LEDGYRWRKY GQKAVKNSPY 120 PRSYYRCTTQ KCPVKKRVER SYQDPAVVIT TWYRVFYWVS YHFYALTS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-23 | 91 | 152 | 7 | 68 | Probable WRKY transcription factor 4 |
2lex_A | 4e-23 | 91 | 152 | 7 | 68 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | KN539717.1_FGP004 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY341844 | 1e-133 | AY341844.1 Oryza sativa (japonica cultivar-group) WRKY3 mRNA, complete cds. | |||
GenBank | AY341855 | 1e-133 | AY341855.1 Oryza sativa (japonica cultivar-group) WRKY14 mRNA, complete cds. | |||
GenBank | AY870604 | 1e-133 | AY870604.1 Oryza sativa (japonica cultivar-group) WRKY16 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002458273.1 | 7e-46 | probable WRKY transcription factor 48 | ||||
Swissprot | Q8VWJ2 | 6e-41 | WRK28_ARATH; WRKY transcription factor 28 | ||||
TrEMBL | A0A287L9A2 | 1e-51 | A0A287L9A2_HORVV; Uncharacterized protein | ||||
STRING | MLOC_54606.1 | 4e-49 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2125 | 37 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18170.1 | 1e-39 | WRKY DNA-binding protein 28 |
Publications ? help Back to Top | |||
---|---|---|---|
|