PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539504.1_FGP009
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 933aa    MW: 101791 Da    PI: 6.0088
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539504.1_FGP009genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.18.4e-29562613152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isl++l+kyFs+++kdAAk+Lgvc+T+LKriCR++GI+RWP+Rki+++
  KN539504.1_FGP009 562 AEKNISLDVLRKYFSGSLKDAAKSLGVCPTTLKRICRHHGISRWPSRKINKV 613
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.995548633IPR003035RWP-RK domain
PfamPF020426.8E-26565613IPR003035RWP-RK domain
SuperFamilySSF542771.77E-22823910No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-21829910No hitNo description
PROSITE profilePS5174523.964832912IPR000270PB1 domain
SMARTSM006666.5E-18832912IPR000270PB1 domain
PfamPF005648.0E-16833909IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MDMPTPSNRA GCNGNTGGTM GPSDDPYGAA AMNLDCYSEI YSPSVADQLF SLLNDPAAHR  60
MFAMWPSMGS SPCAAGMSED TPLDTYSGLG EAVEEPSQIM PVNPTEAEKT GKCSGELGSD  120
DGAHQGSSMV PRESLGSGAL AQVWMPVEQE GHVVLSTCEQ PFLLDQVLAG YREVSRHFVF  180
SAKEEPGLQP GLPGRVFISG VPEWTSSVLY YNRPEYLRME HALHHEIRGS LAMPIYDPSK  240
DSCCAVFELV TRKEKPDFSA EMDNAVNLKA TKGSSNQKVP SSLLSSERLY CDNFSCTPWK  300
NFYTENQKFA FTEILDVLRA ICHAHMLPLA LTWVPTSNGI DGGYVVGKDG ASFSQSGKTI  360
IRIHESACYV NDGKMQGFLQ ACARRHLEKG QGIAGRALKS NLPFFSPDIR EYSIEDYPLA  420
HHARKFSLHA AVAIRLRSTY TGNDDYILEF FLPVSCKGSG EQQMLLNNLS STMQRICKSL  480
RTVYEAEVDN VNAGTAAVFR KNNESCLPTG HTESSSHGDQ SITGASFEDT SLANKPGVME  540
PELAEQVQPS SIGHAEKKRS TAEKNISLDV LRKYFSGSLK DAAKSLGVCP TTLKRICRHH  600
GISRWPSRKI NKVNRSLKKI QTVINSVHGV DRSLQYDPAT GSLVPVVSLP EKLTFPSCDG  660
LPTPSVGKTV EENSDLKSEE GCSLPDGSQR QSCQLQISDV KKSNEDEFHI GSGNSDFYGA  720
NATAKSNSEV TQGPLCPTGA FSALHLKGTD CTNPSSSLRP SSESTRDQIV GRNSPSIQQE  780
DLDMLDSHEA KDKDHMHPST SGMTDSSSGS ASSHPTFKQN TRSALKDTAS PALTVKATYN  840
EDTVRFKFLP SMGWYHLLEE IAKRFKLPTG AFQLKYKDDE DEWVILANDS DLQECVDVLD  900
SIGSRNVKLQ QTEPHDSVAI RVYDAFAAKR HGG
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539504.1_FGP009
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0607530.0AK060753.1 Oryza sativa Japonica Group cDNA clone:001-032-G10, full insert sequence.
GenBankAK1031540.0AK103154.1 Oryza sativa Japonica Group cDNA clone:J033120P08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015636521.10.0protein NLP2
RefseqXP_015636522.10.0protein NLP2
RefseqXP_015636523.10.0protein NLP2
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLA0A0E0PB030.0A0A0E0PB03_ORYRU; Uncharacterized protein
STRINGORUFI04G18750.10.0(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.21e-168Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]