PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539443.1_FGP011
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 269aa    MW: 31119 Da    PI: 7.6612
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539443.1_FGP011genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.54.1e-26130179352
             RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        ++i+l d+++yF+lpi++A+++L++++++LKr+CRqy+I+RWPhRkiksl
  KN539443.1_FGP011 130 ASITLVDIAQYFHLPIREASRTLKIGVSILKRKCRQYNIPRWPHRKIKSL 179
                        78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.395114199IPR003035RWP-RK domain
PfamPF020423.0E-21131179IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MDAAAAAVST LSALAVFAST LDHGAVRSVH GYKVYGRGGR RRWERNPRLM CVPSLYNDLE  60
KVFRFQNVEK IPKLMQCDSE EKLSSWDARD KSSDEVHASE SDDSDDDLQS GEEEKSTVQK  120
QRRANKKHIA SITLVDIAQY FHLPIREASR TLKIGVSILK RKCRQYNIPR WPHRKIKSLD  180
SLIQDLEYVI DDGDDHDDTG DDVQQEKHKQ TAEEKQEAIM ALTRRKQMLE TEKETIQQIP  240
AMDLKVETKQ FREDVFKRRY RAKKDLAND
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257264RRYRAKKD
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539443.1_FGP011
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066281e-137AL606628.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0017B10, complete sequence.
GenBankAP0149601e-137AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-137CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634161.11e-147protein RKD5 isoform X1
TrEMBLA0A0E0DH821e-147A0A0E0DH82_9ORYZ; Uncharacterized protein
STRINGOMERI04G17610.11e-148(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.12e-36RWP-RK domain-containing protein