PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539373.1_FGP008
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Nin-like
Protein Properties Length: 232aa    MW: 27334 Da    PI: 6.3168
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539373.1_FGP008genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.34.7e-26113163252
             RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        e ++++e +s+yF lpik+AA++L+v+lT+LKr+CR +GI+RWPhRk+ksl
  KN539373.1_FGP008 113 ERTLTFELVSQYFCLPIKQAAQKLNVGLTLLKRRCRVLGIPRWPHRKVKSL 163
                        5789*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.26995184IPR003035RWP-RK domain
PfamPF020424.5E-22115163IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEKWRFCGGH QFQSYSFHEE ENLFQDWSLD YLLLGEDEPF FTHHFSTSVH SNFVQDELYT  60
LFDGDILSIW GDMKEDAYHK SDKDGGEKEE KLDHEKAMEL QLQRLPSGRQ SGERTLTFEL  120
VSQYFCLPIK QAAQKLNVGL TLLKRRCRVL GIPRWPHRKV KSLETLIKNV QELGMETGQD  180
EDNTRNAVEM LQQTKKLIEK SPDAKLDDWT KMLRQACFKE NYKRRRLLAI EG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222226KRRRL
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKN539373.1_FGP008
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126101e-180CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627113.11e-170protein RKD1
RefseqXP_015627115.11e-170protein RKD1
SwissprotQ9M9U95e-40RKD1_ARATH; Protein RKD1
TrEMBLA0A0D9YY631e-169A0A0D9YY63_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HLA41e-169A0A0E0HLA4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NKW91e-169A0A0E0NKW9_ORYRU; Uncharacterized protein
TrEMBLA2X9K21e-169A2X9K2_ORYSI; Uncharacterized protein
TrEMBLI1P4801e-169I1P480_ORYGL; Uncharacterized protein
STRINGOGLUM02G32960.11e-169(Oryza glumipatula)
STRINGORUFI02G34010.11e-169(Oryza rufipogon)
STRINGONIVA06G04700.11e-169(Oryza nivara)
STRINGORGLA02G0278600.11e-169(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.11e-42RWP-RK domain-containing protein