PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

KN539363.1_FGP005

Organism

Oryza longistaminata

Taxonomic ID

4528

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza

Family

M-type_MADS

Protein Properties

Length: 117aa MW: 12780.6 Da PI: 9.5113

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
KN539363.1_FGP005	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.7	5.5e-32	51	101	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+++fss+g+lyeys+ KN539363.1_FGP005 51 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVVFSSRGRLYEYSN 101 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.282	43	103	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-39	43	102	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.52E-39	45	102	No hit	No description
PRINTS	PR00404	1.9E-33	45	65	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	45	99	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.44E-29	45	103	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.5E-27	52	99	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-33	65	80	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.9E-33	80	101	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 117 aa Download sequence Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGG SGGSGLVGAE KIGSRGKIEI KRIENTTNRQ 60 VTFCKRRNGL LKKAYELSVL CDAEVALVVF SSRGRLYEYS NNRYCIPLPL FSSRNLN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
1tqe_R	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
1tqe_S	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
3mu6_A	1e-19	45	102	2	59	Myocyte-specific enhancer factor 2A
3mu6_B	1e-19	45	102	2	59	Myocyte-specific enhancer factor 2A
3mu6_C	1e-19	45	102	2	59	Myocyte-specific enhancer factor 2A
3mu6_D	1e-19	45	102	2	59	Myocyte-specific enhancer factor 2A
6c9l_A	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
6c9l_B	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
6c9l_C	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
6c9l_D	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
6c9l_E	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
6c9l_F	1e-19	45	101	3	59	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	KN539363.1_FGP005

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB232157	1e-155	AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBank	AK111723	1e-155	AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
GenBank	FJ750942	1e-155	FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015638060.1	2e-53	MADS-box transcription factor 58 isoform X1
Refseq	XP_025881631.1	6e-54	MADS-box transcription factor 58 isoform X2
Swissprot	Q2V0P1	8e-56	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A0E0DN63	2e-66	A0A0E0DN63_9ORYZ; Uncharacterized protein
STRING	OMERI05G05690.1	6e-67	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G58780.2	1e-37	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]